TkA05G243410 | RubberDandelionOmics

Gene overview

TkA05G243410

Reference: TK1151 Chr: Chr05 Coordinates: 60610805-60614386 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2099 bp · TkA05G243410|TK1151|cDNA

TTGTAATTTACTCATAGATTATATGAAATTGTGTTTGGGTGCGAAAGATCCGGTACAACATGGTTATCATCGACACACAACACAAGTATACACGCAAAATAAGAAATCGTTGTGTCAGCCGTCGCCAAGTCACAGTCGCTTGAACATCTATCTCTCTTCGCCACAAAACCCCTCCATTAAAACCAACGCCGTTACGCTTAAGCAATATCCATTCTCCAAACTCATCATCCCCTTCAATCCTAATCTATCAACTCTAATCA...

CDS

Download CDS FASTA

1623 bp · TkA05G243410|TK1151|CDS

ATGGAGTCTCCGATTCTTCCTGCAATAATCCGATTCCGAGCTTCTGCAAATTCGTTTTTGTCACAGTTCGAACCTCTGGTCCTCTTTTTTGCTCCTCTCGTAACTTTCCTCATCGCCCAGATTGTTCAATCTCTTATTCAAGTTGTTCATGAGAAGGGATTCAAAGCGACGCTGATTGGTTTTGTCATGACATTGGCCAAGTTGGTGCCTGGTGTGAAGAGGTATATTGATGCTGAGAAACAGAAGGTGGTTGAGAAACT...

Protein

Download Protein FASTA

540 aa · TkA05G243410|TK1151|PROTEIN

MESPILPAIIRFRASANSFLSQFEPLVLFFAPLVTFLIAQIVQSLIQVVHEKGFKATLIGFVMTLAKLVPGVKRYIDAEKQKVVEKLQSSGKSQRDGWRTELPGSGLGNRVIEQMKAEKQKDAAWQGKCSGTVYIGGNESEGHFSLINEACSMFAHTNPLHLDVFKSVVRFEAEVVGMTAALLGSKDKASGGQVCGNMTSGGTESILLAVKSSRDYMKTKKNITCPEMIIPESAHSAYDKAAQYFKIKLWRVPVNKAFQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G243410`
TK1151 ID	TkA05G243410
OH-1004 ID	LXL04_020586
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G243410

Location Chr05:60610805-60614386 (+)

Description Similar to DPL1: Sphingosine-1-phosphate lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27980`	Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine.	Arabidopsis mutants lacking long chain base phosphate lyase are fumonisin-sensitive and accumulate trihydroxy-18:1 long chain base phosphate.2007 · DOI: 10.1074/jbc.m705074200 Degradation of sphingoid long-chain base 1-phosphates (LCB-1Ps): functional characterization and expression of AtDPL1 encoding LCB-1P lyase involved in the dehydration stress response in Arabidopsis.2008 · DOI: 10.1093/pcp/pcn149

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0100900`	Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020586 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001667 ameboidal-type cell migration Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0008209 androgen metabolic process Biological Process

GO:0008210 estrogen metabolic process Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010761 fibroblast migration Biological Process

GO:0019752 carboxylic acid metabolic process Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030149 sphingolipid catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G27980

ddi:DDB_G0282819

dosa:Os01g0100900

mmu:20397

rno:286896

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.760

Rank 1 · TkA05G243410 · TK1151

Mitochondrion0.108

Rank 2 · TkA05G243410 · TK1151

Cytoplasm0.105

Rank 3 · TkA05G243410 · TK1151

Cell membrane0.072

Rank 4 · TkA05G243410 · TK1151

Nucleus0.057

Rank 5 · TkA05G243410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00282Pyridoxal_deC156-445 aa

PF00266Aminotran_5199-462 aa

PF01041DegT_DnrJ_EryC1199-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G243410	`PF00282`	Pyridoxal_deC	156	445	9.1e-23	81.3
TkA05G243410	`PF00266`	Aminotran_5	199	462	1.4e-10	41.5
TkA05G243410	`PF01041`	DegT_DnrJ_EryC1	199	310	0.098	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C509`	Arabidopsis thaliana	sp\|Q9C509\|SGPL_ARATH Sphingosine-1-phosphate lyase	77.900%	Swiss-Prot	High
`Q52RG7`	Oryza sativa subsp. japonica	sp\|Q52RG7\|SGPL_ORYSJ Sphingosine-1-phosphate lyase	72.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card