TkA05G239150 | RubberDandelionOmics

Gene overview

TkA05G239150

Reference: TK1151 Chr: Chr05 Coordinates: 59610811-59613368 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA05G239150|TK1151|cDNA

ATGACAGGATCAAAGTCTCTCCTGGAAGATTATGTCAAGAAAGATGGCCCAGTGGTTACATACGGAGACAACAGCAAGGGTCACATCAAAGGCTTCGGAACAATCAAATGCAAGAGTGTCGCGTTCAAAAACGTGTCGTACGTCAAAGGACTCAAGCATAACCTCATATCCATCAGTCAGCTTTGTGACGCTGATTATGAGGTTCATTTTAGCAAGAAAGAAGGAAAGGTCAGCAACACCACTAATACTCATGTTCTCAC...

CDS

Download CDS FASTA

360 bp · TkA05G239150|TK1151|CDS

ATGACAGGATCAAAGTCTCTCCTGGAAGATTATGTCAAGAAAGATGGCCCAGTGGTTACATACGGAGACAACAGCAAGGGTCACATCAAAGGCTTCGGAACAATCAAATGCAAGAGTGTCGCGTTCAAAAACGTGTCGTACGTCAAAGGACTCAAGCATAACCTCATATCCATCAGTCAGCTTTGTGACGCTGATTATGAGGTTCATTTTAGCAAGAAAGAAGGAAAGGTCAGCAACACCACTAATACTCATGTTCTCAC...

Protein

Download Protein FASTA

119 aa · TkA05G239150|TK1151|PROTEIN

MTGSKSLLEDYVKKDGPVVTYGDNSKGHIKGFGTIKCKSVAFKNVSYVKGLKHNLISISQLCDADYEVHFSKKEGKVSNTTNTHVLTAKRKDDIYVLDMFSADETLWQCVYSCSQASLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G239150`
TK1151 ID	TkA05G239150
OH-1004 ID	LXL04_029250
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 99.160 / OH-1004 24.790 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G239150`
Location	Chr05:59610811-59613368 (+)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029250` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0032196 transposition Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · TkA05G239150 · TK1151

Nucleus0.226

Rank 2 · TkA05G239150 · TK1151

Peroxisome0.100

Rank 3 · TkA05G239150 · TK1151

Mitochondrion0.079

Rank 4 · TkA05G239150 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA05G239150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22936Pol_BBD1-66 aa

PF22936Pol_BBD74-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G239150	`PF22936`	Pol_BBD	1	66	4.5e-11	43.6
TkA05G239150	`PF22936`	Pol_BBD	74	95	4.5e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card