TkA05G232530 | RubberDandelionOmics

Gene overview

TkA05G232530

Reference: TK1151 Chr: Chr05 Coordinates: 58139229-58142662 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1580 bp · TkA05G232530|TK1151|cDNA

GACACGGATCGCTGACTCACCCCCTTTTCCCTCTGTCTCTTTCCGTCGCCATCCCTCCTTCATCGACTCAAGGCCATACCTCCTGACCTCCATACCTCCACAGTTCAGACCATACCTCCATCAAATACTCTCCATCCCTTGATTCTCCTTCATTTTAAATTTTGAAATAGAAATACCCTCCCTTCTCTCAATCTTTCAAACTAACCCTAAATTCCTAAAACCTGGCACTCACCGCAACAACGAATCGACATCAGTACATC...

CDS

Download CDS FASTA

594 bp · TkA05G232530|TK1151|CDS

ATGGAAGAGCTGTCGAAAGATGTGGTTTTATGCATATCAGTATCATCTTCATTGCCAAATTGGATGTCGATTTGTTATTGTTTGCTACCGGTAGCCGAAAACCATCTTGATTTGCTCTATTTTTTCAGTTTGTTGGTGGACCCATTTGAGGTGTTTGGCTCCTCCTTTAGGGATTCAAATGGGGTTTTTGGCGGGATGAATGAACAAGAAGGCGATAGTTTCAGTTTCAGAAGCAAGGGCAGCCAAACACTCAACATTCG...

Protein

Download Protein FASTA

197 aa · TkA05G232530|TK1151|PROTEIN

MEELSKDVVLCISVSSSLPNWMSICYCLLPVAENHLDLLYFFSLLVDPFEVFGSSFRDSNGVFGGMNEQEGDSFSFRSKGSQTLNIRHDVFLSFEESIFGAKRDIEVSCLETCDYCGGSGAKSSKCIITCNRCGGRGAVMQTQETPFGVMSQLLERMIRLTKATSAKSLAHLYGTKLRAYLGAHNLGIDLHPQACAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G232530`
TK1151 ID	TkA05G232530
OH-1004 ID	LXL04_003123
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 54.822 / OH-1004 21.012 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G232530

Location Chr05:58139229-58142662 (+)

Description Similar to DJA8: Chaperone protein dnaJ A8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22360`	May function together with HSC70 chaperone to assist protein folding and prevent protein aggregation during heat stress in the chloroplast.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003123 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G22360

dosa:Os05g0333500

dosa:Os05g0334400

osa:107275576

osa:4338449

osa:4338452

tel:tll0790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.340

Rank 1 · TkA05G232530 · TK1151

Cytoplasm0.328

Rank 2 · TkA05G232530 · TK1151

Plastid0.134

Rank 3 · TkA05G232530 · TK1151

Cell membrane0.131

Rank 4 · TkA05G232530 · TK1151

Mitochondrion0.126

Rank 5 · TkA05G232530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17302DUF5351111-121 aa

PF15777Anti-TRAP111-140 aa

PF27659CHP02642112-174 aa

PF20833RNase_E_G_Thio112-121 aa

PF00684DnaJ_CXXCXGXG113-151 aa

PF17302DUF5351129-138 aa

PF20833RNase_E_G_Thio129-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G232530	`PF17302`	DUF5351	111	121	0.085	13.9
TkA05G232530	`PF15777`	Anti-TRAP	111	140	0.099	13.4
TkA05G232530	`PF27659`	CHP02642	112	174	0.0052	17.0
TkA05G232530	`PF20833`	RNase_E_G_Thio	112	121	0.63	10.9
TkA05G232530	`PF00684`	DnaJ_CXXCXGXG	113	151	5.1e-06	27.4
TkA05G232530	`PF17302`	DUF5351	129	138	0.085	13.9
TkA05G232530	`PF20833`	RNase_E_G_Thio	129	160	0.63	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJZ7`	Arabidopsis thaliana	sp\|Q9SJZ7\|DNJA6_ARATH Chaperone protein dnaJ A6, chloroplastic	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card