TkA05G220390 | RubberDandelionOmics

Gene overview

TkA05G220390

Reference: TK1151 Chr: Chr05 Coordinates: 55256342-55257250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

506 bp · TkA05G220390|TK1151|cDNA

GAAGGAATGGGAAGACTGAAGAACAAATTCAAAAGAACGAACTGAAAATGATGATAATGATACCGAGAAAGAACAACCAATCAAGCATCCCAATGGTTGTAAAAGTGTCCAAAACAGGAGGGCCCTGTTTGGAATTTGGTGTCACAGCTTATGCTGATGAGATTGTAATCGATAACTTATCAGTTAAAGATCCAGACATGGCTGAAGACCAGCTTCCATATGAAGGACCAAGATTCGATTCTTTGGCTGCATTTTCTGAT...

CDS

Download CDS FASTA

459 bp · TkA05G220390|TK1151|CDS

ATGATGATAATGATACCGAGAAAGAACAACCAATCAAGCATCCCAATGGTTGTAAAAGTGTCCAAAACAGGAGGGCCCTGTTTGGAATTTGGTGTCACAGCTTATGCTGATGAGATTGTAATCGATAACTTATCAGTTAAAGATCCAGACATGGCTGAAGACCAGCTTCCATATGAAGGACCAAGATTCGATTCTTTGGCTGCATTTTCTGATCAAAAAGAGGTGGCAACAGGCCAACAGCATGAGAATATGGGGAGGTT...

Protein

Download Protein FASTA

153 aa · TkA05G220390|TK1151|PROTEIN

MMIMIPRKNNQSSIPMVVKVSKTGGPCLEFGVTAYADEIVIDNLSVKDPDMAEDQLPYEGPRFDSLAAFSDQKEVATGQQHENMGRFGLSRVQHIFSTWGYFWKNLWVLKHIVTWFSVGNFGLLHPEGLGVFLIWSCTEVIGGTLFSFLFFKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G220390`
TK1151 ID	TkA05G220390
OH-1004 ID	LXL04_035061
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 38.562 / OH-1004 22.433 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G220390

Location Chr05:55256342-55257250 (-)

Description Similar to At2g39795: Uncharacterized protein At2g39795, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39795`	Uncharacterized protein At2g39795, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035061 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0042256 cytosolic ribosome assembly Biological Process

GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0097177 mitochondrial ribosome binding Molecular Function

KEGG gene cross-reference

ath:AT2G39790

ath:AT2G39795

sce:YIL070C

spo:2541189

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.423

Rank 1 · TkA05G220390 · TK1151

Cytoplasm0.396

Rank 2 · TkA05G220390 · TK1151

Endoplasmic reticulum0.153

Rank 3 · TkA05G220390 · TK1151

Mitochondrion0.116

Rank 4 · TkA05G220390 · TK1151

Golgi apparatus0.081

Rank 5 · TkA05G220390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02330MAM339-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G220390	`PF02330`	MAM33	9	66	3.8e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W487`	Arabidopsis thaliana	sp\|Q8W487\|YB95_ARATH Uncharacterized protein At2g39795, mitochondrial	57.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card