TkA05G191160 | RubberDandelionOmics

Gene overview

TkA05G191160

Reference: TK1151 Chr: Chr05 Coordinates: 48512455-48513561 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA05G191160|TK1151|cDNA

CGCTGTTCTTCCGCTGAAATTGACGAATCAACCGCTGACAGTAGCAGCTCAAGCACCTTTAGTGCCGATCTTCAAAAGGCTGCCCGCAACTCCTCCTCCGCTGACTGGGACTCCTCTTCCTTGTTCCTGGTTAAAATTTTTGTAACTTATTCCAGTAATGAAAAGAACGATATGTTTGAGTACTTGTGTCTTCATCTCTCTACTTCAAACGCTGAAAAACTTGTCTTTAAAAATGAAATCAAAGCGTTAAAGGAAAACAT...

CDS

Download CDS FASTA

1107 bp · TkA05G191160|TK1151|CDS

CGCTGTTCTTCCGCTGAAATTGACGAATCAACCGCTGACAGTAGCAGCTCAAGCACCTTTAGTGCCGATCTTCAAAAGGCTGCCCGCAACTCCTCCTCCGCTGACTGGGACTCCTCTTCCTTGTTCCTGGTTAAAATTTTTGTAACTTATTCCAGTAATGAAAAGAACGATATGTTTGAGTACTTGTGTCTTCATCTCTCTACTTCAAACGCTGAAAAACTTGTCTTTAAAAATGAAATCAAAGCGTTAAAGGAAAACAT...

Protein

Download Protein FASTA

368 aa · TkA05G191160|TK1151|PROTEIN

RCSSAEIDESTADSSSSSTFSADLQKAARNSSSADWDSSSLFLVKIFVTYSSNEKNDMFEYLCLHLSTSNAEKLVFKNEIKALKENIIEKDKQVSQMKTLISNLSLTNKFIHTKKDKAIENSNKIQRIINNWAHSHNKLNKIISDQIPEQCAKIIGGQIDEAVAKFEQIKTEQNFPSPAELISDFKTRFVSNNFINQNLINKHCVTDTKGNTTCTTRLTAIDPTIRNGEIIVPTTECCLKFPISNGEIHSTKETLASFPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G191160`
TK1151 ID	TkA05G191160
OH-1004 ID	LXL04_033681
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.800
Protein coverage (%)	TK1151 99.728 / OH-1004 48.928 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G191160`
Location	Chr05:48512455-48513561 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033681` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · TkA05G191160 · TK1151

Nucleus0.429

Rank 2 · TkA05G191160 · TK1151

Mitochondrion0.085

Rank 3 · TkA05G191160 · TK1151

Cell membrane0.042

Rank 4 · TkA05G191160 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA05G191160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07438DUF151441-83 aa

PF24978Death_Lrrd143-90 aa

PF13949ALIX_LYPXL_bnd54-144 aa

PF24555CC4_CEP8578-108 aa

PF02025IL580-130 aa

PF07438DUF151489-128 aa

PF24978Death_Lrrd196-145 aa

PF13949ALIX_LYPXL_bnd158-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G191160	`PF07438`	DUF1514	41	83	2.5	8.8
TkA05G191160	`PF24978`	Death_Lrrd1	43	90	1.3	10.0
TkA05G191160	`PF13949`	ALIX_LYPXL_bnd	54	144	0.39	10.6
TkA05G191160	`PF24555`	CC4_CEP85	78	108	0.019	16.1
TkA05G191160	`PF02025`	IL5	80	130	0.062	14.2
TkA05G191160	`PF07438`	DUF1514	89	128	2.5	8.8
TkA05G191160	`PF24978`	Death_Lrrd1	96	145	1.3	10.0
TkA05G191160	`PF13949`	ALIX_LYPXL_bnd	158	173	0.39	10.6
TkA05G191160	`PF00098`	zf-CCHC	316	331	0.074	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card