TkA05G184330 | RubberDandelionOmics

Gene overview

TkA05G184330

Reference: TK1151 Chr: Chr05 Coordinates: 46906712-46907312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA05G184330|TK1151|cDNA

ATGAAAAAGGCGTTACCGGCTAACGCAAAAGAGATTGTTCAGGAAGCCGTTTCCGAGTTTATTAGCTTATCACTAGAGATTATTCTGTGTAGGGCAAGTGATAAGTGTCAAAAGGATAAGAGGAAAACCATCAGTGGCGATTATCTTTTATGGGCAATGGGTACTCTAGGGTTTGAAGATTTTATCGAGCCACTCAAATTATACCTTAGTAGATATAAAGAGATTTTGAAGCCTGACACAAAGGGATCTGCAAAATGTCA...

CDS

Download CDS FASTA

324 bp · TkA05G184330|TK1151|CDS

ATGAAAAAGGCGTTACCGGCTAACGCAAAAGAGATTGTTCAGGAAGCCGTTTCCGAGTTTATTAGCTTATCACTAGAGATTATTCTGTGTAGGGCAAGTGATAAGTGTCAAAAGGATAAGAGGAAAACCATCAGTGGCGATTATCTTTTATGGGCAATGGGTACTCTAGGGTTTGAAGATTTTATCGAGCCACTCAAATTATACCTTAGTAGATATAAAGAGATTTTGAAGCCTGACACAAAGGGATCTGCAAAATGTCA...

Protein

Download Protein FASTA

107 aa · TkA05G184330|TK1151|PROTEIN

MKKALPANAKEIVQEAVSEFISLSLEIILCRASDKCQKDKRKTISGDYLLWAMGTLGFEDFIEPLKLYLSRYKEILKPDTKGSAKCHESSLRRDGLQSDYDQNAQVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G184330`
TK1151 ID	TkA05G184330
OH-1004 ID	LXL04_032702
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 100.000 / OH-1004 46.581 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G184330

Location Chr05:46906712-46907312 (+)

Description Similar to NFYB8: Nuclear transcription factor Y subunit B-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37060`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`At3g53340`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`At2g38880`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0573500`	Component of the NF-Y/HAP transcription factor complex.	OsHAP3 genes regulate chloroplast biogenesis in rice.2003 · DOI: 10.1046/j.1365-313x.2003.01897.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032702 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G37060

ath:AT2G38880

ath:AT3G53340

osa:9268669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.855

Rank 1 · TkA05G184330 · TK1151

Cytoplasm0.266

Rank 2 · TkA05G184330 · TK1151

Mitochondrion0.026

Rank 3 · TkA05G184330 · TK1151

Cell membrane0.024

Rank 4 · TkA05G184330 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA05G184330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00808CBFD_NFYB_HMF8-53 aa

PF15468DUF463625-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G184330	`PF00808`	CBFD_NFYB_HMF	8	53	9.3e-08	33.0
TkA05G184330	`PF15468`	DUF4636	25	102	0.14	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYK4`	Arabidopsis thaliana	sp\|Q8VYK4\|NFYB8_ARATH Nuclear transcription factor Y subunit B-8	56.600%	Swiss-Prot	High
`Q67XJ2`	Arabidopsis thaliana	sp\|Q67XJ2\|NFYBA_ARATH Nuclear transcription factor Y subunit B-10	58.000%	Swiss-Prot	High
`Q9SLG0`	Arabidopsis thaliana	sp\|Q9SLG0\|NFYB1_ARATH Nuclear transcription factor Y subunit B-1	60.400%	Swiss-Prot	High
`Q60EQ4`	Oryza sativa subsp. japonica	sp\|Q60EQ4\|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3	58.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card