TkA05G168240 | RubberDandelionOmics

Gene overview

TkA05G168240

Reference: TK1151 Chr: Chr05 Coordinates: 43244957-43246736 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

658 bp · TkA05G168240|TK1151|cDNA

AATCAGTTCACAATTTCATCGCCTCCAACCCTCCACGGCTCCAACTCCATTGCAGCTCCACCCTCGAACGGCGACTCCAAGTGCACCTCTACCGCTGCACCGCAATCGTTGCACCACCGCTGCCTGAAGAACGTCGGACCACTGAAGCAGCCGAAGGTCACAGAAATCACAAGAACGATGGGACTCCAATCACAATCCTATGGTATCCAGGGAATGCTAAAAGAAGGGCACAAACACCTTTCTGAATTAGATGAAGCCGT...

CDS

Download CDS FASTA

366 bp · TkA05G168240|TK1151|CDS

AATCAGTTCACAATTTCATCGCCTCCAACCCTCCACGGCTCCAACTCCATTGCAGCTCCACCCTCGAACGGCGACTCCAAGTGCACCTCTACCGCTGCACCGCAATCGTTGCACCACCGCTGCCTGAAGAACGTCGGACCACTGAAGCAGCCGAAGGTCACAGAAATCACAAGAACGATGGGACTCCAATCACAATCCTATGGTATCCAGGGAATGCTAAAAGAAGGGCACAAACACCTTTCTGAATTAGATGAAGCCGT...

Protein

Download Protein FASTA

121 aa · TkA05G168240|TK1151|PROTEIN

NQFTISSPPTLHGSNSIAAPPSNGDSKCTSTAAPQSLHHRCLKNVGPLKQPKVTEITRTMGLQSQSYGIQGMLKEGHKHLSELDEAVVKNIDACKQLSTITRTSLGPNGCPDLGVIGGGRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G168240`
TK1151 ID	TkA05G168240
OH-1004 ID	LXL04_032481
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 41.322 / OH-1004 9.174 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G168240

Location Chr05:43244957-43246736 (+)

Description Similar to CCT8: T-complex protein 1 subunit theta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03960`	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0007339 binding of sperm to zona pellucida Biological Process

GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051050 positive regulation of transport Biological Process

GO:0002199 zona pellucida receptor complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005832 chaperonin-containing T-complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G03960

cbr:CBG_08425

ddi:DDB_G0276233

gga:418486

mmu:12469

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.434

Rank 1 · TkA05G168240 · TK1151

Cytoplasm0.369

Rank 2 · TkA05G168240 · TK1151

Cell membrane0.130

Rank 3 · TkA05G168240 · TK1151

Mitochondrion0.116

Rank 4 · TkA05G168240 · TK1151

Endoplasmic reticulum0.082

Rank 5 · TkA05G168240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K05`	Arabidopsis thaliana	sp\|Q94K05\|TCPQ_ARATH T-complex protein 1 subunit theta	76.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card