RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G141820
Reference: TK1151 Chr: Chr05 Coordinates: 36868659-36869006 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

348 bp · TkA05G141820|TK1151|cDNA

CCCTCTATTCTCTCTCAAAGAAATCGGAACCCTTGGAACTCCTTCATCCCATCGTCGCCGACGAGACCTCCGACAGCCCCGACGACCACTCGCCTCCGCCGTTGCGTCGATTCCCAGCGTCCTTCGACCGCTGCTGCTCCGGATCCCCCTGTTGTCACCGATTCCGAGCCCTATTTCGATGTTCGCTGCTGCTCCGAACCTTGCTCAGCCGATTTCTTCCCTGTTCAGTCGGGTTCTTCCGTGTCCAAGGAATTTCTTCT...

CDS

Download CDS FASTA

348 bp · TkA05G141820|TK1151|CDS

CCCTCTATTCTCTCTCAAAGAAATCGGAACCCTTGGAACTCCTTCATCCCATCGTCGCCGACGAGACCTCCGACAGCCCCGACGACCACTCGCCTCCGCCGTTGCGTCGATTCCCAGCGTCCTTCGACCGCTGCTGCTCCGGATCCCCCTGTTGTCACCGATTCCGAGCCCTATTTCGATGTTCGCTGCTGCTCCGAACCTTGCTCAGCCGATTTCTTCCCTGTTCAGTCGGGTTCTTCCGTGTCCAAGGAATTTCTTCT...

Protein

Download Protein FASTA

115 aa · TkA05G141820|TK1151|PROTEIN

PSILSQRNRNPWNSFIPSSPTRPPTAPTTTRLRRCVDSQRPSTAAAPDPPVVTDSEPYFDVRCCSEPCSADFFPVQSGSSVSKEFLLFSNIIRLQFGCLSHFFYRLAFYPLKFIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G141820
TK1151 IDTkA05G141820
OH-1004 IDLXL04_000293
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)95.200
Protein coverage (%)TK1151 90.435 / OH-1004 22.511
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G141820
LocationChr05:36868659-36869006 (+)
DescriptionSimilar to ORG2: Transcription factor ORG2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010104 regulation of ethylene-activated signaling pathway Biological Process
GO:0010106 cellular response to iron ion starvation Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0046685 response to arsenic-containing substance Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process
KEGG gene cross-reference
ath:AT2G41240
ath:AT3G56970
ath:AT3G56980
dosa:Os01g0952800
osa:4325750
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.498
Rank 1 · TkA05G141820 · TK1151
Cytoplasm0.359
Rank 2 · TkA05G141820 · TK1151
Cell membrane0.088
Rank 3 · TkA05G141820 · TK1151
Endoplasmic reticulum0.078
Rank 4 · TkA05G141820 · TK1151
Mitochondrion0.066
Rank 5 · TkA05G141820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser