Gene Card
Gene overview
cDNA / CDS / Protein Sequences
883 bp · TkA05G141440|TK1151|cDNA
GTACCAATATCCTCTACCAGTGGTTTTTTTGAACATGAACAATCGCAACAACAATCTCATGCACACTGTCTATTGGCACCATGCTGATACACCATCTGAAGTTTCTTCAATATCACATATTCCTAGCTCTGGGCCCGGTGTAGTAGGTCGAATGGGTTCATTTGGGTCGATTCAGGATAGAGCGTATGTTCTACCATTTGCTTTTAGGGTTACATCTCAACCTACGACACAAAACCTATCAAGCAACAACACCATTCAAA...
663 bp · TkA05G141440|TK1151|CDS
ATGAACAATCGCAACAACAATCTCATGCACACTGTCTATTGGCACCATGCTGATACACCATCTGAAGTTTCTTCAATATCACATATTCCTAGCTCTGGGCCCGGTGTAGTAGGTCGAATGGGTTCATTTGGGTCGATTCAGGATAGAGCGTATGTTCTACCATTTGCTTTTAGGGTTACATCTCAACCTACGACACAAAACCTATCAAGCAACAACACCATTCAAAGAAACGCACACTTGAGGCAAGCATCCACCATCCA...
Protein
Download Protein FASTA220 aa · TkA05G141440|TK1151|PROTEIN
MNNRNNNLMHTVYWHHADTPSEVSSISHIPSSGPGVVGRMGSFGSIQDRAYVLPFAFRVTSQPTTQNLSSNNTIQRNAHLRQASTIQSPYSAEPNKGLEKLKKEIYNPGVQRVSLYYRDPDFRAKLLEKTKNEDGKRCAVCLDDFEPGEIVTLTPCRHMFHENCIVPWVTSNGQCPVCRFVINDRSKEREETQTGNNRVLGGDPIPRDLINFIREMENRG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G141440 |
|---|---|
| TK1151 ID | TkA05G141440 |
| OH-1004 ID | LXL04_020129 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 99.545 / OH-1004 79.636Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G141440 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:36775709-36777135 (+) | |||||||||
| Description | Similar to SDIR1: E3 ubiquitin-protein ligase SDIR1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G19950 ath:AT3G55530 mcf:102146898 xla:444028 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23074PH_FT_N5-20 aaPF23074PH_FT_N98-142 aaPF04423Rad50_zn_hook125-148 aaPF14446Prok-RING_1132-165 aaPF29452FAR1_N135-191 aaPF13920zf-C3HC4_3136-183 aaPF17120zf-RING_16136-177 aaPF14835zf-RING_6136-179 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G141440 | PF23074 | PH_FT_N | 5 | 20 | 0.097 | 13.1 |
| TkA05G141440 | PF23074 | PH_FT_N | 98 | 142 | 0.097 | 13.1 |
| TkA05G141440 | PF04423 | Rad50_zn_hook | 125 | 148 | 0.24 | 12.0 |
| TkA05G141440 | PF14446 | Prok-RING_1 | 132 | 165 | 0.00012 | 22.9 |
| TkA05G141440 | PF29452 | FAR1_N | 135 | 191 | 0.27 | 12.0 |
| TkA05G141440 | PF13920 | zf-C3HC4_3 | 136 | 183 | 6.2e-06 | 26.6 |
| TkA05G141440 | PF17120 | zf-RING_16 | 136 | 177 | 0.0014 | 18.9 |
| TkA05G141440 | PF14835 | zf-RING_6 | 136 | 179 | 0.002 | 18.6 |
| TkA05G141440 | PF13639 | zf-RING_2 | 137 | 179 | 8.6e-15 | 55.5 |
| TkA05G141440 | PF13923 | zf-C3HC4_2 | 137 | 178 | 1.8e-10 | 41.1 |
| TkA05G141440 | PF14634 | zf-RING_5 | 137 | 179 | 1.4e-07 | 32.0 |
| TkA05G141440 | PF23555 | zf-RING_Vps41 | 137 | 172 | 0.0024 | 18.2 |
| TkA05G141440 | PF17123 | zf-RING_11 | 138 | 165 | 3.7e-11 | 43.2 |
| TkA05G141440 | PF00097 | zf-C3HC4 | 138 | 178 | 1.1e-08 | 35.5 |
| TkA05G141440 | PF13445 | zf-RING_UBOX | 138 | 176 | 1.2e-06 | 29.1 |
| TkA05G141440 | PF00628 | PHD | 138 | 173 | 0.0057 | 17.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.