TkA05G140390 | RubberDandelionOmics

Gene overview

TkA05G140390

Reference: TK1151 Chr: Chr05 Coordinates: 36543043-36544497 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

902 bp · TkA05G140390|TK1151|cDNA

AGAAAAGGTTACCCTACAACACCAGATCATGATATGCTCCCAGTTCAAAATAACAAGAATGAGGGACAAGTAGCAGCTCCTGAAACTGAATCGCCCAAGTGTGTTTTTCAATTAAGTTTGCGGGAGAGACTACAACTCCTGTGACAAAGTTGTCGGATAACAGTTGTAGTAAAGATTGGATGTTAAATTCAGGAGAAATGTCAGTTAGTCAACCGAAGCCAAGGTTTAAAAGATTACGTAAATATGGTGATATAAAAGCT...

CDS

Download CDS FASTA

591 bp · TkA05G140390|TK1151|CDS

ATGTTAAATTCAGGAGAAATGTCAGTTAGTCAACCGAAGCCAAGGTTTAAAAGATTACGTAAATATGGTGATATAAAAGCTCGAAATTTGTCACAAGTGGAAGTTGTAGGCCGTACATCTTGTGCTCCATTTTCCAATAAGCGCAGTAGAGGTGACAAGAAGGTGTTAAATGATGCCAGAATTTTTATCGACAATGAGGCCGAGGTGTCTTCAGAAGGGTCTGGTGATGAGGATGAGGGTGTTGACCAGGGTCAAGATTC...

Protein

Download Protein FASTA

196 aa · TkA05G140390|TK1151|PROTEIN

MLNSGEMSVSQPKPRFKRLRKYGDIKARNLSQVEVVGRTSCAPFSNKRSRGDKKVLNDARIFIDNEAEVSSEGSGDEDEGVDQGQDSYDDSFIDDRINPTVAMQDECDMMAIYRRSLLTQSPAMRTPQFPVEEGGSTSRTTNTNNYSTSVSFNTARLTSDTGIPTTTTGITSTDSGIWKESRVFLMVTHTHYRFVT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G140390`
TK1151 ID	TkA05G140390
OH-1004 ID	LXL04_020121
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 90.306 / OH-1004 56.325 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G140390

Location Chr05:36543043-36544497 (+)

Description Similar to FANCM: DEAD-box ATP-dependent RNA helicase FANCM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35530`	Involved in ordered homologous recombination (HR) events in somatic and meiotic cells.	The Fanconi anemia ortholog FANCM ensures ordered homologous recombination in both somatic and meiotic cells in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096644 FANCM limits meiotic crossovers.2012 · DOI: 10.1126/science.1220381 The requirement for recombination factors differs considerably between different pathways of homologous double-strand break repair in somatic plant cells.2012 · DOI: 10.1111/j.1365-313x.2012.05119.x MHF1 plays Fanconi anaemia complementation group M protein (FANCM)-dependent and FANCM-independent roles in DNA repair and homologous recombination in plants.2014 · DOI: 10.1111/tpj.12507 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.2014 · DOI: 10.1093/nar/gku614 AAA-ATPase FIDGETIN-LIKE 1 and Helicase FANCM Antagonize Meiotic Crossovers by Distinct Mechanisms.2015 · DOI: 10.1371/journal.pgen.1005369

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020121 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0045128 negative regulation of reciprocal meiotic recombination Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0000400 four-way junction DNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009378 four-way junction helicase activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0043138 3'-5' DNA helicase activity Molecular Function

KEGG gene cross-reference

ath:AT1G35530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA05G140390 · TK1151

Cytoplasm0.222

Rank 2 · TkA05G140390 · TK1151

Mitochondrion0.025

Rank 3 · TkA05G140390 · TK1151

Cell membrane0.018

Rank 4 · TkA05G140390 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA05G140390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11942Spt5_N62-99 aa

PF059024_1_CTD138-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G140390	`PF11942`	Spt5_N	62	99	0.024	16.3
TkA05G140390	`PF05902`	4_1_CTD	138	183	0.26	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`I3XHK1`	Arabidopsis thaliana	sp\|I3XHK1\|FANCM_ARATH DEAD-box ATP-dependent RNA helicase FANCM	37.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card