TkA05G114940 | RubberDandelionOmics

Gene overview

TkA05G114940

Reference: TK1151 Chr: Chr05 Coordinates: 30683859-30684986 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

725 bp · TkA05G114940|TK1151|cDNA

TTCTCGAAATGCGTTCAAGAATGTGTGTTTTGAAAGCAAGTGGAGAAGCTGAAGGACTTTGTGCACAATTAAATAGAGAAGTCCGTGTTGATGCTTGTATTACTTATGATAGTGATGCGTTTCTTTTTGGTGCCAAATGTATCATTAAAAACATTAAGCCCAATTCACAGGAACCATTTGAGTGCTATGAAATGTCGGATGTGGAAATTGGATTAGGGTTAAAGAGAAAACATTTAATAGCAATTGGACTTTTGGTTGGA...

CDS

Download CDS FASTA

717 bp · TkA05G114940|TK1151|CDS

ATGCGTTCAAGAATGTGTGTTTTGAAAGCAAGTGGAGAAGCTGAAGGACTTTGTGCACAATTAAATAGAGAAGTCCGTGTTGATGCTTGTATTACTTATGATAGTGATGCGTTTCTTTTTGGTGCCAAATGTATCATTAAAAACATTAAGCCCAATTCACAGGAACCATTTGAGTGCTATGAAATGTCGGATGTGGAAATTGGATTAGGGTTAAAGAGAAAACATTTAATAGCAATTGGACTTTTGGTTGGAAATGATCA...

Protein

Download Protein FASTA

239 aa · TkA05G114940|TK1151|PROTEIN

MRSRMCVLKASGEAEGLCAQLNREVRVDACITYDSDAFLFGAKCIIKNIKPNSQEPFECYEMSDVEIGLGLKRKHLIAIGLLVGNDHDLKGVQGIGIETALSFVKSFKEYEVLDRLCGLGSGNMLPIAYEGDLVNNLDENTTKIKLSHCSLCGHPGSKRSHLKYSCEVCISNNHQSCVQKPIGFKCNCMSCDQDKKEKEQKKNEAWKMRVCSKISTEPNFPNKEIIEMYLSNNHSNFTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G114940`
TK1151 ID	TkA05G114940
OH-1004 ID	LXL04_022686
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.600
Protein coverage (%)	TK1151 97.908 / OH-1004 40.068 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G114940

Location Chr05:30683859-30684986 (+)

Description Similar to GEN1: Flap endonuclease GEN-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01880`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	AtGEN1 and AtSEND1, two paralogs in Arabidopsis, possess holliday junction resolvase activity.2014 · DOI: 10.1104/pp.114.237834
`UniProt: Q9M2Z3`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0521900`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA.	No verified direct reference in this release
`Os08g0101600`	Single-stranded DNA endonuclease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022686 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0009555 pollen development Biological Process

GO:0009650 UV protection Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0031297 replication fork processing Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0071140 resolution of mitotic recombination intermediates Biological Process

GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005813 centrosome Cellular Component

KEGG gene cross-reference

ath:AT1G01880

dpo:4814122

hsa:348654

mmu:209334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.759

Rank 1 · TkA05G114940 · TK1151

Cytoplasm0.256

Rank 2 · TkA05G114940 · TK1151

Mitochondrion0.073

Rank 3 · TkA05G114940 · TK1151

Cell membrane0.028

Rank 4 · TkA05G114940 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA05G114940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00867XPG_I7-86 aa

PF12813XPG_I_211-43 aa

PF013675_3_exonuc76-113 aa

PF26054PHD_G2E3138-159 aa

PF03107C1_2145-178 aa

PF00130C1_1145-180 aa

PF26054PHD_G2E3165-178 aa

PF00867XPG_I185-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G114940	`PF00867`	XPG_I	7	86	1.9e-19	70.5
TkA05G114940	`PF12813`	XPG_I_2	11	43	0.17	12.1
TkA05G114940	`PF01367`	5_3_exonuc	76	113	0.06	14.6
TkA05G114940	`PF26054`	PHD_G2E3	138	159	7.6	7.3
TkA05G114940	`PF03107`	C1_2	145	178	0.0062	17.6
TkA05G114940	`PF00130`	C1_1	145	180	2.0	9.0
TkA05G114940	`PF26054`	PHD_G2E3	165	178	7.6	7.3
TkA05G114940	`PF00867`	XPG_I	185	229	1.9e-19	70.5
TkA05G114940	`PF26054`	PHD_G2E3	185	213	7.6	7.3
TkA05G114940	`PF03107`	C1_2	186	194	0.0062	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPD2`	Arabidopsis thaliana	sp\|Q9LPD2\|GENL1_ARATH Flap endonuclease GEN-like 1	56.800%	Swiss-Prot	High
`Q9M2Z3`	Arabidopsis thaliana	sp\|Q9M2Z3\|GENL2_ARATH Single-strand DNA endonuclease 1	42.600%	Swiss-Prot	Low
`Q64MA3`	Oryza sativa subsp. japonica	sp\|Q64MA3\|GENL1_ORYSJ Flap endonuclease GEN-like 1	51.300%	Swiss-Prot	High
`Q8W5R1`	Oryza sativa subsp. japonica	sp\|Q8W5R1\|GENL2_ORYSJ Single-strand DNA endonuclease 1	42.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card