TkA05G109070 | RubberDandelionOmics

Gene overview

TkA05G109070

Reference: TK1151 Chr: Chr05 Coordinates: 29216641-29217974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1165 bp · TkA05G109070|TK1151|cDNA

TAGTTTAAGTTGGCCGCTTGGCCCCTTCTTGTAAAAAAGCCCAATGCCATCAACACATAAATGATCATTGATCAGCCCACAAAAGCAGAGGAAGATCAAGAGACAAGAGAGGAAAAAGAAAAAGGCGGAAAGGGCACAATGCGTTTCACAGACTCGCCGGTGATCGACCTCACTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGTTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTCGTTCTCGT...

CDS

Download CDS FASTA

660 bp · TkA05G109070|TK1151|CDS

ATGATCATTGATCAGCCCACAAAAGCAGAGGAAGATCAAGAGACAAGAGAGGAAAAAGAAAAAGGCGGAAAGGGCACAATGCGTTTCACAGACTCGCCGGTGATCGACCTCACTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGTTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTCGTTCTCGTCAAATTCGCCGAGCGTTGGCTCTCTTCCACTTCCACCACCGACAACCCCTACGCAACCGT...

Protein

Download Protein FASTA

219 aa · TkA05G109070|TK1151|PROTEIN

MIIDQPTKAEEDQETREEKEKGGKGTMRFTDSPVIDLTVNNSKLSFHQDNGSMHVGTTVWPASLVLVKFAERWLSSTSTTDNPYATVLHFQNKRAVELGTGCGVAAMGLYLLGLKDVVLTDIAPVMPALKHNLKRNKTVLGKMLKTAQLHWTNSDQIKALKPPFDIVVAADVVYIEESVGPLLAAMESMVSDTGVVLLGYQVRSPEAHLLFWEQCNRIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G109070`
TK1151 ID	TkA05G109070
OH-1004 ID	LXL04_019968
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 79.348 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G109070`
Location	Chr05:29216641-29217974 (-)
Description	Similar to VCPKMT: Protein-lysine methyltransferase METTL21D
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019968` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006479 protein methylation Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0018023 peptidyl-lysine trimethylation Biological Process GO:0032259 methylation Biological Process GO:0032780 negative regulation of ATP-dependent activity Biological Process GO:1903333 negative regulation of protein folding Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0008276 protein methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference	cel:CELE_C42C1.13 hsa:151194 hsa:79609 mmu:207965 xtr:100038275 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · TkA05G109070 · TK1151

Nucleus0.452

Rank 2 · TkA05G109070 · TK1151

Mitochondrion0.094

Rank 3 · TkA05G109070 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA05G109070 · TK1151

Cell membrane0.061

Rank 5 · TkA05G109070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_1640-205 aa

PF13489Methyltransf_2389-206 aa

PF06325PrmA92-170 aa

PF08241Methyltransf_1198-197 aa

PF08242Methyltransf_12100-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G109070	`PF10294`	Methyltransf_16	40	205	2.2e-27	96.7
TkA05G109070	`PF13489`	Methyltransf_23	89	206	2.5e-05	24.8
TkA05G109070	`PF06325`	PrmA	92	170	0.00021	21.6
TkA05G109070	`PF08241`	Methyltransf_11	98	197	0.022	16.1
TkA05G109070	`PF08242`	Methyltransf_12	100	195	0.00057	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card