TkA05G107450 | RubberDandelionOmics

Gene overview

TkA05G107450

Reference: TK1151 Chr: Chr05 Coordinates: 28814591-28822693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1553 bp · TkA05G107450|TK1151|cDNA

AAAAGATGCTTCTTCCTTGCTATAAAATAGATGGTCATGGCCGTCTCAACCACCCGACTGCATAATAGTGCAGAGCTACAAAGAAAGATCCCATTCGTATCATTCATTATCCATGCTAATGAAGAAGTGGGCATTCAGGCGGAACTTACAGCAGAAGCCAGCATCGGCTAGCGATCTCACGATGCTCATGTCAAATCTCAATCAATCTGCAGACAGCAAACCTATAATCTCAATGGCCCATGGCGAACCATATGTCTCCC...

CDS

Download CDS FASTA

990 bp · TkA05G107450|TK1151|CDS

ATGCTAATGAAGAAGTGGGCATTCAGGCGGAACTTACAGCAGAAGCCAGCATCGGCTAGCGATCTCACGATGCTCATGTCAAATCTCAATCAATCTGCAGACAGCAAACCTATAATCTCAATGGCCCATGGCGAACCATATGTCTCCCCTTGTTTCAGTACCATCCAGATTGGAACAGATGCCATTGCGGAAGCTGTCCATTCTGCTAAATTCAACGGTTATTCTGCAACCGCAGGGCTTCTCCCAGCTAGAAGGAGTGT...

Protein

Download Protein FASTA

329 aa · TkA05G107450|TK1151|PROTEIN

MLMKKWAFRRNLQQKPASASDLTMLMSNLNQSADSKPIISMAHGEPYVSPCFSTIQIGTDAIAEAVHSAKFNGYSATAGLLPARRSVAEYLSMGLPDKLSPDDVFLTMGCKHAAQNILTVLSGSNSNILFPKPSFPYYEILARSCHLEVRHFDLLPEKDWEVDLDSVESIADENTVAMIIINPGNPCGNVFTHQHLKKVAETAKKLGILVIADEVYDHIAFGKNPFVSMGVFGSIVPVVTLGSLSKRWIVPGWRLGWLVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G107450`
TK1151 ID	TkA05G107450
OH-1004 ID	LXL04_025571
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.000
Protein coverage (%)	TK1151 92.097 / OH-1004 73.558 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G107450

Location Chr05:28814591-28822693 (-)

Description Similar to NAAT1: Nicotianamine aminotransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53970`	Probable aminotransferase TAT2.	No verified direct reference in this release
`At5g36160`	Transaminase involved in tyrosine breakdown.	Identification and Partial Characterization of an L-Tyrosine Aminotransferase (TAT) from Arabidopsis thaliana.2010 · DOI: 10.1155/2010/549572
`At2g20610`	C-S lyase involved in glucosinolate biosynthesis.	Arabidopsis mutants in the C-S lyase of glucosinolate biosynthesis establish a critical role for indole-3-acetaldoxime in auxin homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02002.x
`At4g28420`	Probable aminotransferase TAT1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0306401`	Involved in biosynthesis of mugineic acid family phytosiderophores, which are ferric iron chelators produced in graminaceous plants in response to iron deficiency.	Identification and localisation of the rice nicotianamine aminotransferase gene OsNAAT1 expression suggests the site of phytosiderophore synthesis in rice.2008 · DOI: 10.1007/s11103-007-9262-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001560 regulation of cell growth by extracellular stimulus Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006559 L-phenylalanine catabolic process Biological Process

GO:0006572 L-tyrosine catabolic process Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0048830 adventitious root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G20610

ath:AT5G36160

ath:AT5G53970

dosa:Os02g0306401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.386

Rank 1 · TkA05G107450 · TK1151

Plastid0.183

Rank 2 · TkA05G107450 · TK1151

Peroxisome0.146

Rank 3 · TkA05G107450 · TK1151

Nucleus0.120

Rank 4 · TkA05G107450 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA05G107450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02827PKI17-35 aa

PF00155Aminotran_1_241-324 aa

PF00266Aminotran_5141-215 aa

PF01053Cys_Met_Meta_PP145-216 aa

PF01212Beta_elim_lyase158-213 aa

PF00202Aminotran_3162-215 aa

PF02827PKI293-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G107450	`PF02827`	PKI	17	35	0.098	13.7
TkA05G107450	`PF00155`	Aminotran_1_2	41	324	9.7e-42	144.2
TkA05G107450	`PF00266`	Aminotran_5	141	215	0.038	13.7
TkA05G107450	`PF01053`	Cys_Met_Meta_PP	145	216	0.14	11.4
TkA05G107450	`PF01212`	Beta_elim_lyase	158	213	0.081	13.0
TkA05G107450	`PF00202`	Aminotran_3	162	215	0.013	14.9
TkA05G107450	`PF02827`	PKI	293	318	0.098	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN30`	Arabidopsis thaliana	sp\|Q9FN30\|TAT2_ARATH Probable aminotransferase TAT2	57.400%	Swiss-Prot	High
`Q9LVY1`	Arabidopsis thaliana	sp\|Q9LVY1\|TAT_ARATH Tyrosine aminotransferase	49.800%	Swiss-Prot	Medium
`Q9SIV0`	Arabidopsis thaliana	sp\|Q9SIV0\|SUR1_ARATH S-alkyl-thiohydroximate lyase SUR1	51.300%	Swiss-Prot	High
`Q67Y55`	Arabidopsis thaliana	sp\|Q67Y55\|TAT1_ARATH Probable aminotransferase TAT1	48.700%	Swiss-Prot	Medium
`A0A0P0VI36`	Oryza sativa subsp. japonica	sp\|A0A0P0VI36\|NAAT1_ORYSJ Nicotianamine aminotransferase 1	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card