TkA05G102270 | RubberDandelionOmics

Gene overview

TkA05G102270

Reference: TK1151 Chr: Chr05 Coordinates: 27462767-27465999 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1737 bp · TkA05G102270|TK1151|cDNA

CGGACTTGACGCCTTAACTGCCGGTAGGACCCACTGAAAAGGAAAATCGGTACGACCGTAAATAACTGAAGTCATCCAGGGTACTTTTGTAAATTTAGCATCACAAGCTCTTGTGTATGTTACCCGTGCTCTCTTTGTCGCCTCTTTTAGCCTCCTTATATACCGATGTGAAAAGCTCAGTCCTAATACCGTGGAAGTCCAACTCTGTAAACCCAGTGTCGGTACTCTCTCTCTCATAATTATTCTCTCTCTCTCTCTAA...

CDS

Download CDS FASTA

843 bp · TkA05G102270|TK1151|CDS

ATGGCGCTTATATCAGACAATTTGAGCGGCTCCGGTCGCTACACCAGCTGCATTTCCAAAATGTGTTTTGCTGTGATGTGGTGTTTCGCGGCTGTGGTGTTTCAGAGTTTGAAGATCTCCGGTGGGCCGATTATGAACTCTGTTAACTCACATTGGCGTCCGGCTACTGCGACGTGGTACGGCAGTCCAGAAGGAGACGGAAGCGATGGTGGCGCGTGTGGCTACGGATCTCTCGTGGATGTGAAGCCATTCAGAGCGCG...

Protein

Download Protein FASTA

280 aa · TkA05G102270|TK1151|PROTEIN

MALISDNLSGSGRYTSCISKMCFAVMWCFAAVVFQSLKISGGPIMNSVNSHWRPATATWYGSPEGDGSDGGACGYGSLVDVKPFRARVGAVSPILFKAGEGCGACYKVKCLDKSICSRRAVTVIITDECPGGYCSGGNTHFDLSGAAFGRMAVAGDHSQLRNRGVLNIVYRRTPCKYPGRNIAFHVNEGSTNYWLSLLVEFEGGDGDVGSMHIREAKSTEWLEMSHVWGANWVIVRGPLRGPFSVKLTSLSTKRTLSARD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G102270`
TK1151 ID	TkA05G102270
OH-1004 ID	LXL04_019895
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G102270

Location Chr05:27462767-27465999 (-)

Description Similar to EXPB3: Expansin-B3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28250`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g20750`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g65680`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0639500`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os04g0530100`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019895 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65680

ath:AT2G20750

ath:AT4G28250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.418

Rank 1 · TkA05G102270 · TK1151

Lysosome / Vacuole0.125

Rank 2 · TkA05G102270 · TK1151

Cell membrane0.100

Rank 3 · TkA05G102270 · TK1151

Plastid0.090

Rank 4 · TkA05G102270 · TK1151

Cytoplasm0.065

Rank 5 · TkA05G102270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01357Expansin_C47-59 aa

PF22514EXPB1_D155-138 aa

PF03330DPBB_157-73 aa

PF29515Expansin_N67-152 aa

PF03330DPBB_190-170 aa

PF01357Expansin_C182-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G102270	`PF01357`	Expansin_C	47	59	3.7e-25	88.6
TkA05G102270	`PF22514`	EXPB1_D1	55	138	2.4e-05	25.4
TkA05G102270	`PF03330`	DPBB_1	57	73	9.2e-16	58.6
TkA05G102270	`PF29515`	Expansin_N	67	152	3.8e-07	31.0
TkA05G102270	`PF03330`	DPBB_1	90	170	9.2e-16	58.6
TkA05G102270	`PF01357`	Expansin_C	182	263	3.7e-25	88.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0I2`	Arabidopsis thaliana	sp\|Q9M0I2\|EXPB3_ARATH Expansin-B3	77.200%	Swiss-Prot	High
`Q9SKU2`	Arabidopsis thaliana	sp\|Q9SKU2\|EXPB1_ARATH Expansin-B1	70.000%	Swiss-Prot	High
`Q9SHY6`	Arabidopsis thaliana	sp\|Q9SHY6\|EXPB2_ARATH Putative expansin-B2	50.900%	Swiss-Prot	High
`Q0DZ85`	Oryza sativa subsp. japonica	sp\|Q0DZ85\|EXB16_ORYSJ Expansin-B16	69.600%	Swiss-Prot	High
`Q7X6J9`	Oryza sativa subsp. japonica	sp\|Q7X6J9\|EXB17_ORYSJ Expansin-B17	74.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card