TkA05G101560 | RubberDandelionOmics

Gene overview

TkA05G101560

Reference: TK1151 Chr: Chr05 Coordinates: 27288232-27288843 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · TkA05G101560|TK1151|cDNA

ATGACCGAAGCTAGTGAGAAAAAAGTCTATAGCGGTTGTGTCCGATGCATGTGTTGGTGTTGTTGTCTCCTTTTCCTCCTAATCATAATTTCCGTAGGCCTAGCACTATACATCTACAACACCGAAAAGCCTAAAGCACCAACATACGACATCCAATCATTCACTGTCAAATGCCTTGAACTTCGAGACGATTTAAGTCTCAAAACCGAGTTCGTGGTCAATGTTATGACCAACAACCCAAACAAAAACATCGGATTCGT...

CDS

Download CDS FASTA

612 bp · TkA05G101560|TK1151|CDS

ATGACCGAAGCTAGTGAGAAAAAAGTCTATAGCGGTTGTGTCCGATGCATGTGTTGGTGTTGTTGTCTCCTTTTCCTCCTAATCATAATTTCCGTAGGCCTAGCACTATACATCTACAACACCGAAAAGCCTAAAGCACCAACATACGACATCCAATCATTCACTGTCAAATGCCTTGAACTTCGAGACGATTTAAGTCTCAAAACCGAGTTCGTGGTCAATGTTATGACCAACAACCCAAACAAAAACATCGGATTCGT...

Protein

Download Protein FASTA

203 aa · TkA05G101560|TK1151|PROTEIN

MTEASEKKVYSGCVRCMCWCCCLLFLLIIISVGLALYIYNTEKPKAPTYDIQSFTVKCLELRDDLSLKTEFVVNVMTNNPNKNIGFVYGEKSNVSILYNDVIISSGKLPAFRQGPASTTILKIAMAGTSPNVTDSFQDEVNSSEDEDGIPLVVIVKVPMKVYVGNVGLKEFIALVICDLVVENLESGQNAKVLENGCEADIEF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G101560`
TK1151 ID	TkA05G101560
OH-1004 ID	LXL04_003560
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	31.300
Protein coverage (%)	TK1151 78.818 / OH-1004 54.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G101560`
Location	Chr05:27288232-27288843 (-)
Description	Similar to NHL6: NDR1/HIN1-like protein 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003560` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process GO:0010150 leaf senescence Biological Process GO:0042742 defense response to bacterium Biological Process GO:0051607 defense response to virus Biological Process GO:0051707 response to other organism Biological Process GO:0098542 defense response to other organism Biological Process GO:0110126 phloem loading Biological Process GO:1902074 response to salt Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G65690 ath:AT2G27080 ath:AT2G35980 ath:AT3G11650 ath:AT5G53730 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.662

Rank 1 · TkA05G101560 · TK1151

Endoplasmic reticulum0.113

Rank 2 · TkA05G101560 · TK1151

Cytoplasm0.112

Rank 3 · TkA05G101560 · TK1151

Lysosome / Vacuole0.100

Rank 4 · TkA05G101560 · TK1151

Extracellular0.097

Rank 5 · TkA05G101560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12751Vac78-96 aa

PF03168LEA_278-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G101560	`PF12751`	Vac7	8	96	0.39	10.8
TkA05G101560	`PF03168`	LEA_2	78	156	3.1e-05	25.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card