TkA05G098910 | RubberDandelionOmics

Gene overview

TkA05G098910

Reference: TK1151 Chr: Chr05 Coordinates: 26640689-26642369 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1330 bp · TkA05G098910|TK1151|cDNA

GTTAGAAAAACCCTTCCACTATATGATCAAGACTTTTATTAAAAAAGTTTGACGGGTTATAACAGGTCCAGGGAACATATTTGGTTTAATCAATTATTTAAATTTGCTGTCATCTATTTGGAGATGAGGAATTGGATAGAGGAACTATGATTCCCACCCACAAATACATCAAAGACAATTTCCTGCTGCACATTGAGTCATAATCGGCTCCAATTGATGATGGCAGCTCTCGGTCTAATTCCACCATACTTTTAGGGTTC...

CDS

Download CDS FASTA

897 bp · TkA05G098910|TK1151|CDS

ATGCTCAAATCGACGTTTTCCTGCTGTAAAGTCTACATATCCGAGACACGAAACAAATCCGCTCTTAATTCAATCGAACAAGCTGCAAAGTTATTCCCAGAGGCGGCCATTGTCAACAAATTTCAGGACGAGACTTACAACAGAGTAGGATACACGCTTGTCTCAAAATCCTCCCCAAATTCCTCCCCAGATTCACCTCCCTTAAAGCACGCCGTTTTCTCAATGGTGAAAGCAGCTTTCGAAGCCATTGATTTCGGATT...

Protein

Download Protein FASTA

298 aa · TkA05G098910|TK1151|PROTEIN

MLKSTFSCCKVYISETRNKSALNSIEQAAKLFPEAAIVNKFQDETYNRVGYTLVSKSSPNSSPDSPPLKHAVFSMVKAAFEAIDFGLHSGTHPRLGVVDHICFHPLASSSLEDIAGTAKSLASDIGSILKVPTYTYGAAHNTQRSLDSIRRALGYFNPTTTTHHWSGAPQSTTLALEPDHGPAQVVQSKGVVTIGATKWVDNYNVPVFSDNMAKVRRIAKRVSGRGGGLDSVQSMALAHGEVIEVACNLLDPGAVGGDRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G098910`
TK1151 ID	TkA05G098910
OH-1004 ID	LXL04_019873
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 91.611 / OH-1004 57.717 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G098910

Location Chr05:26640689-26642369 (+)

Description Similar to M5005_Spy1772: Glutamate formimidoyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20830`	Involved in the regulation of root growth.	AtFTCD-L, a trans-Golgi network localized protein, modulates root growth of Arabidopsis in high-concentration agar culture medium.2022 · DOI: 10.1007/s00425-022-03911-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019873 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006548 L-histidine catabolic process Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0019556 L-histidine catabolic process to glutamate and formamide Biological Process

GO:0019557 L-histidine catabolic process to glutamate and formate Biological Process

GO:0035999 tetrahydrofolate interconversion Biological Process

GO:0046903 secretion Biological Process

GO:0048364 root development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G20830

rno:89833

spy:SPy_2083

spz:M5005_Spy1772

ssc:397517

tac:Ta1476

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.633

Rank 1 · TkA05G098910 · TK1151

Nucleus0.444

Rank 2 · TkA05G098910 · TK1151

Mitochondrion0.088

Rank 3 · TkA05G098910 · TK1151

Peroxisome0.057

Rank 4 · TkA05G098910 · TK1151

Cell membrane0.044

Rank 5 · TkA05G098910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07837FTCD_N8-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G098910	`PF07837`	FTCD_N	8	197	1.3e-51	175.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKT4`	Arabidopsis thaliana	sp\|Q9SKT4\|FTCDL_ARATH Formiminotransferase cyclodeaminase-like protein	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card