TkA05G095790 | RubberDandelionOmics

Gene overview

TkA05G095790

Reference: TK1151 Chr: Chr05 Coordinates: 25839490-25840088 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA05G095790|TK1151|cDNA

ATGTCCACAACGCAGTCACTATGGCCGACGGACGTCAACGCTTTCCGCATCTCCGCCGTCACTAGCCGATCACTCGATCACGTTTGTGGTGACACAAATATGGAGAACAGAAAGTTCTTTGACCTCTACCTCTTTATTTCCAGGGGTATCGATTATGCGGTTGCCAACAGTGAGATCCCTGGCGGAGCTCAAGATTTACCCTATTTAATAAAACATGTTACTTTAACTTCTCCTCAACTGTTCTTTATCAATTATGCGAC...

CDS

Download CDS FASTA

342 bp · TkA05G095790|TK1151|CDS

ATGTCCACAACGCAGTCACTATGGCCGACGGACGTCAACGCTTTCCGCATCTCCGCCGTCACTAGCCGATCACTCGATCACGTTTGTGGTGACACAAATATGGAGAACAGAAAGTTCTTTGACCTCTACCTCTTTATTTCCAGGGGTATCGATTATGCGGTTGCCAACAGTGAGATCCCTGGCGGAGCTCAAGATTTACCCTATTTAATAAAACATGTTACTTTAACTTCTCCTCAACTGTTCTTTATCAATTATGCGAC...

Protein

Download Protein FASTA

113 aa · TkA05G095790|TK1151|PROTEIN

MSTTQSLWPTDVNAFRISAVTSRSLDHVCGDTNMENRKFFDLYLFISRGIDYAVANSEIPGGAQDLPYLIKHVTLTSPQLFFINYATRNILMSNPQSHYYVIRYVSGKTDHNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G095790`
TK1151 ID	TkA05G095790
OH-1004 ID	LXL04_026396
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.000
Protein coverage (%)	TK1151 64.602 / OH-1004 9.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G095790

Location Chr05:25839490-25840088 (-)

Description Similar to PIAL2: E4 SUMO-protein ligase PIAL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41580`	Together with MOM1 and PIAL1, regulates transcriptional gene silencing (TGS) independently of changes in DNA methylation.	Arabidopsis PIAL1 and 2 promote SUMO chain formation as E4-type SUMO ligases and are involved in stress responses and sulfur metabolism.2014 · DOI: 10.1105/tpc.114.131300 The SUMO E3 Ligase-Like Proteins PIAL1 and PIAL2 Interact with MOM1 and Form a Novel Complex Required for Transcriptional Silencing.2016 · DOI: 10.1105/tpc.15.00997

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026396 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0030999 linear element assembly Biological Process

GO:0031297 replication fork processing Biological Process

GO:0032480 negative regulation of type I interferon production Biological Process

GO:0036299 non-recombinational interstrand cross-link repair Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0060339 negative regulation of type I interferon-mediated signaling pathway Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0072766 centromere clustering at the mitotic interphase nuclear envelope Biological Process

KEGG gene cross-reference

ath:AT1G08910

ath:AT5G41580

dre:406712

mmu:52915

spo:2541580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.360

Rank 1 · TkA05G095790 · TK1151

Nucleus0.337

Rank 2 · TkA05G095790 · TK1151

Mitochondrion0.234

Rank 3 · TkA05G095790 · TK1151

Cell membrane0.073

Rank 4 · TkA05G095790 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA05G095790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26716PIAL1_N10-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G095790	`PF26716`	PIAL1_N	10	75	6.8e-16	59.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JYG0`	Arabidopsis thaliana	sp\|F4JYG0\|PIAL2_ARATH E4 SUMO-protein ligase PIAL2	32.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card