TkA05G092610 | RubberDandelionOmics

Gene overview

TkA05G092610

Reference: TK1151 Chr: Chr05 Coordinates: 25001279-25005632 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA05G092610|TK1151|cDNA

ATGGCCCTATTCTGCCCGCAATATGCGGCAAACAAGGAGATGAAGATTAAGATTATGAGATACATAGACGTGTTGCGTACCGATATTAGAGAGTTTGTAGTCGCCACGCCATTCACTACACTTGTAGCTCTCATGCAGGCTGCTAGGAGGCGCGAGTTGGAGCTTGAGACCCAGGCTCGGAGTGAGTACCAATTGCGGGAACATGATAGTAGCAGACCAGTTAGATGTTACAAGTGCGGTCATCCAGGGCACCGTAGTCA...

CDS

Download CDS FASTA

906 bp · TkA05G092610|TK1151|CDS

ATGGCCCTATTCTGCCCGCAATATGCGGCAAACAAGGAGATGAAGATTAAGATTATGAGATACATAGACGTGTTGCGTACCGATATTAGAGAGTTTGTAGTCGCCACGCCATTCACTACACTTGTAGCTCTCATGCAGGCTGCTAGGAGGCGCGAGTTGGAGCTTGAGACCCAGGCTCGGAGTGAGTACCAATTGCGGGAACATGATAGTAGCAGACCAGTTAGATGTTACAAGTGCGGTCATCCAGGGCACCGTAGTCA...

Protein

Download Protein FASTA

301 aa · TkA05G092610|TK1151|PROTEIN

MALFCPQYAANKEMKIKIMRYIDVLRTDIREFVVATPFTTLVALMQAARRRELELETQARSEYQLREHDSSRPVRCYKCGHPGHRSQECKLEGREVIGQEGHMKTNCPSLKDGGGRGAPQVVVATPLRIFDGRVGQIESGGPRGGGVHQLIGKDVQATPEWCDRMDRMGAFDMEIVWRRKQVLLMARRDGRPPPLPGSRKTFLPFSRHQQSPLIRYQTLSPSLLDGIANLKLDEAVPRSKGGEDEAKKTPPEQTKPEDVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G092610`
TK1151 ID	TkA05G092610
OH-1004 ID	LXL04_007346
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.200
Protein coverage (%)	TK1151 60.133 / OH-1004 36.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G092610`
Location	Chr05:25001279-25005632 (-)
Description	Similar to gag-pol: Gag-Pol polyprotein (Human immunodeficiency virus type 2 subtype A (isolate D194)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007346` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0039657 symbiont-mediated suppression of host gene expression Biological Process GO:0039702 viral budding via host ESCRT complex Biological Process GO:0044826 viral genome integration into host DNA Biological Process GO:0046718 symbiont entry into host cell Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0075713 establishment of integrated proviral latency Biological Process GO:0075732 viral penetration into host nucleus Biological Process GO:0019013 viral nucleocapsid Cellular Component GO:0019028 viral capsid Cellular Component
KEGG gene cross-reference	vg:1489982 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.520

Rank 1 · TkA05G092610 · TK1151

Cytoplasm0.452

Rank 2 · TkA05G092610 · TK1151

Mitochondrion0.071

Rank 3 · TkA05G092610 · TK1151

Cell membrane0.054

Rank 4 · TkA05G092610 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA05G092610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13917zf-CCHC_374-93 aa

PF00098zf-CCHC75-90 aa

PF00098zf-CCHC98-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G092610	`PF13917`	zf-CCHC_3	74	93	0.076	13.6
TkA05G092610	`PF00098`	zf-CCHC	75	90	3.1e-07	30.9
TkA05G092610	`PF00098`	zf-CCHC	98	109	3.1e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card