TkA05G090200 | RubberDandelionOmics

Gene overview

TkA05G090200

Reference: TK1151 Chr: Chr05 Coordinates: 24363335-24364330 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · TkA05G090200|TK1151|cDNA

ATGCTTCTCGCCGTCATAATCACGGCAACCCTCCGCTCCCACCACCACCGCCAACTACCAAACGACTCCTCGTCCTTCACCGACCTCACCACCAACGCTTCCGAACTACTCCGATCAAATGGATTCAACTTCATAGCCACGTTCCTCCACATCTCACCGGACCTCTTCCTATCAACACCACAAACCACCATATTTGCCATCCCTGATGTCGCTATCTCAAGCCTTTCCATGCCTCCTTACATGATCAAACACCTCCTCGC...

CDS

Download CDS FASTA

996 bp · TkA05G090200|TK1151|CDS

ATGCTTCTCGCCGTCATAATCACGGCAACCCTCCGCTCCCACCACCACCGCCAACTACCAAACGACTCCTCGTCCTTCACCGACCTCACCACCAACGCTTCCGAACTACTCCGATCAAATGGATTCAACTTCATAGCCACGTTCCTCCACATCTCACCGGACCTCTTCCTATCAACACCACAAACCACCATATTTGCCATCCCTGATGTCGCTATCTCAAGCCTTTCCATGCCTCCTTACATGATCAAACACCTCCTCGC...

Protein

Download Protein FASTA

331 aa · TkA05G090200|TK1151|PROTEIN

MLLAVIITATLRSHHHRQLPNDSSSFTDLTTNASELLRSNGFNFIATFLHISPDLFLSTPQTTIFAIPDVAISSLSMPPYMIKHLLAYHISPEKLAIEDLFKKPPKTCLPTLIQHQKVSITKNDYKHHVVEINNVLITHPNLFLQGPVTIHGVAGTFASFDHNQESITLPLCESGGGGGGNSSRGFIKNKEEWGRVVKFLSSSGFMPFAIGLNSVMQGILKDFPDLNSVTIFTPPNFALMGMPSPLLDKFMRFHIVPLKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G090200`
TK1151 ID	TkA05G090200
OH-1004 ID	LXL04_019822
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G090200

Location Chr05:24363335-24364330 (+)

Description Similar to FLA21: Fasciclin-like arabinogalactan protein 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06920`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019822 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G15190

ath:AT5G06920

ath:AT5G40940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.431

Rank 1 · TkA05G090200 · TK1151

Cell membrane0.185

Rank 2 · TkA05G090200 · TK1151

Endoplasmic reticulum0.176

Rank 3 · TkA05G090200 · TK1151

Cytoplasm0.111

Rank 4 · TkA05G090200 · TK1151

Lysosome / Vacuole0.055

Rank 5 · TkA05G090200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15131DUF45678-20 aa

PF02469Fasciclin66-153 aa

PF15131DUF456775-91 aa

PF15131DUF4567126-160 aa

PF02469Fasciclin221-322 aa

PF15131DUF4567293-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G090200	`PF15131`	DUF4567	8	20	0.42	11.6
TkA05G090200	`PF02469`	Fasciclin	66	153	1.9e-14	54.6
TkA05G090200	`PF15131`	DUF4567	75	91	0.42	11.6
TkA05G090200	`PF15131`	DUF4567	126	160	0.42	11.6
TkA05G090200	`PF02469`	Fasciclin	221	322	1.9e-14	54.6
TkA05G090200	`PF15131`	DUF4567	293	309	0.42	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL53`	Arabidopsis thaliana	sp\|Q9FL53\|FLA21_ARATH Fasciclin-like arabinogalactan protein 21	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card