TkA05G089340 | RubberDandelionOmics

Gene overview

TkA05G089340

Reference: TK1151 Chr: Chr05 Coordinates: 24139050-24139755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA05G089340|TK1151|cDNA

ATGGCAGACGCTAGCGGAGGCTACACTAAGTTTCTGACGGTGCCGACTCACGGAGGTCAGTTCATCCGCTATAACATCTTCGGTAATGAATTTGAGATCACCAACAAGTATTGTCCTCCAATCATGCCTATTGGTCTTGGTGCTTATGGAATTGTCTGCTCGATGTTGAACTCCGAGACGAACAAGATGGTTGTTGTGAAGAAGATTGCAAATGCTTTCGATAATTACATGGACGCTAAGCAGACGCTTCGCGAGATCAA...

CDS

Download CDS FASTA

399 bp · TkA05G089340|TK1151|CDS

ATGGCAGACGCTAGCGGAGGCTACACTAAGTTTCTGACGGTGCCGACTCACGGAGGTCAGTTCATCCGCTATAACATCTTCGGTAATGAATTTGAGATCACCAACAAGTATTGTCCTCCAATCATGCCTATTGGTCTTGGTGCTTATGGAATTGTCTGCTCGATGTTGAACTCCGAGACGAACAAGATGGTTGTTGTGAAGAAGATTGCAAATGCTTTCGATAATTACATGGACGCTAAGCAGACGCTTCGCGAGATCAA...

Protein

Download Protein FASTA

132 aa · TkA05G089340|TK1151|PROTEIN

MADASGGYTKFLTVPTHGGQFIRYNIFGNEFEITNKYCPPIMPIGLGAYGIVCSMLNSETNKMVVVKKIANAFDNYMDAKQTLREIKLLRHLDHENIIAIKDFIPPPLRREFSLSPLALFMIKSLNFGLIYD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G089340`
TK1151 ID	TkA05G089340
OH-1004 ID	LXL04_019815
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G089340

Location Chr05:24139050-24139755 (+)

Description Similar to MPK3: Mitogen-activated protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45640`	Involved in oxidative stress-mediated signaling cascade (such as ozone).	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3.2005 · DOI: 10.1016/j.envpol.2005.04.017 Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543 A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0711301105 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243 The BASL polarity protein controls a MAPK signaling feedback loop in asymmetric cell division.2015 · DOI: 10.1016/j.devcel.2015.02.022
`At2g43790`	Mitogen-activated protein kinase (MAPK) which regulates abscisic acid (ABA) responses in a MAPKKK20-MKK5-MPK6 cascade involved in root growth (e.g. root cell division and elongation) and stomatal response.	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a Silencing of the mitogen-activated protein kinase MPK6 compromises disease resistance in Arabidopsis.2004 · DOI: 10.1105/tpc.015552 The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023 Phosphorylation of 1-aminocyclopropane-1-carboxylic acid synthase by MPK6, a stress-responsive mitogen-activated protein kinase, induces ethylene biosynthesis in Arabidopsis.2004 · DOI: 10.1105/tpc.104.026609 RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3.2005 · DOI: 10.1016/j.envpol.2005.04.017 Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 The mitogen-activated protein kinase cascade MKK3-MPK6 is an important part of the jasmonate signal transduction pathway in Arabidopsis.2007 · DOI: 10.1105/tpc.106.046581 AtMKK1 mediates ABA-induced CAT1 expression and H2O2 production via AtMPK6-coupled signaling in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03433.x Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543 A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0711301105 An arabidopsis mitogen-activated protein kinase cascade, MKK9-MPK6, plays a role in leaf senescence.2009 · DOI: 10.1104/pp.108.133439 AtMKK1 and AtMPK6 are involved in abscisic acid and sugar signaling in Arabidopsis seed germination.2009 · DOI: 10.1007/s11103-009-9503-0 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019815 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

KEGG gene cross-reference

ath:AT2G43790

ath:AT3G45640

cann:107873437

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · TkA05G089340 · TK1151

Nucleus0.307

Rank 2 · TkA05G089340 · TK1151

Cell membrane0.140

Rank 3 · TkA05G089340 · TK1151

Endoplasmic reticulum0.083

Rank 4 · TkA05G089340 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA05G089340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase43-104 aa

PF07714PK_Tyr_Ser-Thr44-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G089340	`PF00069`	Pkinase	43	104	1.2e-11	45.2
TkA05G089340	`PF07714`	PK_Tyr_Ser-Thr	44	101	9.8e-05	22.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39023`	Arabidopsis thaliana	sp\|Q39023\|MPK3_ARATH Mitogen-activated protein kinase 3	73.500%	Swiss-Prot	High
`Q39026`	Arabidopsis thaliana	sp\|Q39026\|MPK6_ARATH Mitogen-activated protein kinase 6	63.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card