Gene Card
Gene overview
cDNA / CDS / Protein Sequences
621 bp · TkA05G088060|TK1151|cDNA
ATGTCACTTCATTGTACGGGGTCTCTGGAGCCAATTTCGCGGAGCACAGTGCTGATTCCGCAGAGCATCTTTTCCATTCCGCAGAGCATCTTATGTCACTTTGATGTACGGGTCTCTGGAGCCAATTTCGCAGAAGGACAGACAATTTCGCGGAGACAGATCGTTCCGTTTTCTACAGTGCTTGGCCCATATCATGTTTCCGACCCGGTTTCTTTCTTGCCTGATCCGAAACTCACCTATTCTGGATTCTTCCTGCCATC...
621 bp · TkA05G088060|TK1151|CDS
ATGTCACTTCATTGTACGGGGTCTCTGGAGCCAATTTCGCGGAGCACAGTGCTGATTCCGCAGAGCATCTTTTCCATTCCGCAGAGCATCTTATGTCACTTTGATGTACGGGTCTCTGGAGCCAATTTCGCAGAAGGACAGACAATTTCGCGGAGACAGATCGTTCCGTTTTCTACAGTGCTTGGCCCATATCATGTTTCCGACCCGGTTTCTTTCTTGCCTGATCCGAAACTCACCTATTCTGGATTCTTCCTGCCATC...
Protein
Download Protein FASTA206 aa · TkA05G088060|TK1151|PROTEIN
MSLHCTGSLEPISRSTVLIPQSIFSIPQSILCHFDVRVSGANFAEGQTISRRQIVPFSTVLGPYHVSDPVSFLPDPKLTYSGFFLPSCPFNWFHSTAFCSGLVFLAAHFLLPPLEFASNPVRAVFASATFPGNHLPAVLLLVFSADLVGSLTHDGWSPSLHRLLTCETAAFPANHAFRPPWFCSVFEQQQSAKVLGFSEGVQRALG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G088060 |
|---|---|
| TK1151 ID | TkA05G088060 |
| OH-1004 ID | LXL04_039825 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 92.500 |
| Protein coverage (%) | TK1151 19.417 / OH-1004 7.080Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G088060 |
|---|---|
| Location | Chr05:23792493-23794177 (+) |
| Description | Similar to Tbc1d15: TBC1 domain family member 15 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006914 autophagy Biological Process GO:0006952 defense response Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043087 regulation of GTPase activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005770 late endosome Cellular Component |
| KEGG gene cross-reference | ath:AT5G53570 cgr:2886868 hsa:64786 mmu:233204 mmu:66687 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.