TkA05G083610 | RubberDandelionOmics

Gene overview

TkA05G083610

Reference: TK1151 Chr: Chr05 Coordinates: 22662007-22665260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1511 bp · TkA05G083610|TK1151|cDNA

ATTTAATATCGCATCGAATCATATGCTCCCCCTAAAAAGGAATCAGGAAGCTTCACTAATCAATAAAGCTGAACGCGTAACCCGTCTCCACCCCACTTCTATCTGGATTTCTACTTTTAGTGGTGATTAAGTATCAAGAGTTGCATCTGCAACCAAAAACAATGGCGAATCCAAGAGTGGCTCCGACGGAAACAGAAGTTGATGAAACGAACAATCAGGCTCATCATCCTTACGCGTTTCATGTATCTGGACCTCGTAAA...

CDS

Download CDS FASTA

1128 bp · TkA05G083610|TK1151|CDS

ATGGCGAATCCAAGAGTGGCTCCGACGGAAACAGAAGTTGATGAAACGAACAATCAGGCTCATCATCCTTACGCGTTTCATGTATCTGGACCTCGTAAAGTTTCTGCCCCAAATTGGCGAGATCTCATCAATTCCAGTTGGAAAGACGGAAACTACAAGAGAACTGTGATCGCCTGCTTTATTCAAGCCGTTTACTTACTAGAACTCGACCGGCAAGAAAACCGACCCAAGGAAACGGCGCTAGCCCCAAAATGGTTCAT...

Protein

Download Protein FASTA

375 aa · TkA05G083610|TK1151|PROTEIN

MANPRVAPTETEVDETNNQAHHPYAFHVSGPRKVSAPNWRDLINSSWKDGNYKRTVIACFIQAVYLLELDRQENRPKETALAPKWFIPFKYKLSRTLIDERDGSIYGAILEWDRSAALSDFILIRPSGAPRAVLALRGTLLKSLTIRRDIEDDLRFLAWESLKGSVRFNGALEALKSIADQYGSHNVAVAGHSLGAGFALQIGKTLAKQGLFVETHLFNPPSVSVAMSLKNMGEKAVFVWQKVKSMMPSAASVADAEDGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G083610`
TK1151 ID	TkA05G083610
OH-1004 ID	LXL04_019761
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G083610`
Location	Chr05:22662007-22665260 (+)
Description	Similar to At4g10955: GDSL esterase/lipase At4g10955
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019761` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016042 lipid catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	ath:AT4G10955 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.296

Rank 1 · TkA05G083610 · TK1151

Cytoplasm0.278

Rank 2 · TkA05G083610 · TK1151

Cell membrane0.163

Rank 3 · TkA05G083610 · TK1151

Nucleus0.158

Rank 4 · TkA05G083610 · TK1151

Endoplasmic reticulum0.128

Rank 5 · TkA05G083610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26363Phospholipase-like130-201 aa

PF01764Lipase_3169-212 aa

PF07859Abhydrolase_3171-254 aa

PF12697Abhydrolase_6172-222 aa

PF00975Thioesterase184-214 aa

PF22790YkoP195-253 aa

PF22790YkoP343-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G083610	`PF26363`	Phospholipase-like	130	201	0.12	12.4
TkA05G083610	`PF01764`	Lipase_3	169	212	5.3e-05	23.9
TkA05G083610	`PF07859`	Abhydrolase_3	171	254	0.047	14.2
TkA05G083610	`PF12697`	Abhydrolase_6	172	222	0.039	15.3
TkA05G083610	`PF00975`	Thioesterase	184	214	0.26	12.2
TkA05G083610	`PF22790`	YkoP	195	253	0.045	13.7
TkA05G083610	`PF22790`	YkoP	343	358	0.045	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card