TkA05G083470 | RubberDandelionOmics

Gene overview

TkA05G083470

Reference: TK1151 Chr: Chr05 Coordinates: 22623130-22624790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1084 bp · TkA05G083470|TK1151|cDNA

CTCAAACTAGCATGATCTATTCAATTAAAAAATAAAAATAAAATAATTCCTTTAAAACAGGGCTTTAAAATAACAATTAGATCTGAAACATCTGGCCGATACTTTTGAGGAGAAGTTGACTCGAATCACCCATCACTTTCAAAGACCCAGTATTTACACTCACATTAAAACAAATCAATTTGAAACAACAAAACCTTTCACAAAGAGGCAATGGGGGGATTTCAGAAGCTAGTCGACGGCATCCTGTTCATCGTCTTCCT...

CDS

Download CDS FASTA

501 bp · TkA05G083470|TK1151|CDS

ATGGGGGGATTTCAGAAGCTAGTCGACGGCATCCTGTTCATCGTCTTCCTCGTGATCGCAATTGGAGCTCCACTTCTCGATGGTCAAACATGTCTTCCTTCCAATTTCTTCCCAGACATCCTGGTAAAGCTCAACGCATGGTACGCCCAAGAATTTGGAGATTATTTGGTCTCTGAAAAACCCCATTTCTTCGTTGGCCTTATTTGGCTCGAGCTTCTCTTCGCGTGGCCCCTAGCGGTTGCTTCTCTCTACGGGATCGT...

Protein

Download Protein FASTA

166 aa · TkA05G083470|TK1151|PROTEIN

MGGFQKLVDGILFIVFLVIAIGAPLLDGQTCLPSNFFPDILVKLNAWYAQEFGDYLVSEKPHFFVGLIWLELLFAWPLAVASLYGIVAGKAWLRTTCLLYGVTTLTAMVAILSELVGSGKASEKLLMLYSPFMGFAVLAILRGLLPNSPKSNAIGTKRALSRKKRA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G083470`
TK1151 ID	TkA05G083470
OH-1004 ID	LXL04_019758
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G083470`
Location	Chr05:22623130-22624790 (+)
Description	Similar to TMEM97: Sigma intracellular receptor 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019758` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001558 regulation of cell growth Biological Process GO:0032377 regulation of intracellular lipid transport Biological Process GO:0032383 regulation of intracellular cholesterol transport Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0140077 positive regulation of lipoprotein transport Biological Process GO:0005764 lysosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005791 rough endoplasmic reticulum Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030867 rough endoplasmic reticulum membrane Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0008142 oxysterol binding Molecular Function
KEGG gene cross-reference	bta:511378 hsa:27346 mmu:69071 rno:303330 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.877

Rank 1 · TkA05G083470 · TK1151

Golgi apparatus0.098

Rank 2 · TkA05G083470 · TK1151

Nucleus0.068

Rank 3 · TkA05G083470 · TK1151

Cytoplasm0.067

Rank 4 · TkA05G083470 · TK1151

Cell membrane0.052

Rank 5 · TkA05G083470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28015LysA7-29 aa

PF05241EBP41-140 aa

PF28015LysA61-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G083470	`PF28015`	LysA	7	29	0.17	12.8
TkA05G083470	`PF05241`	EBP	41	140	7.5e-13	49.5
TkA05G083470	`PF28015`	LysA	61	140	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card