TkA05G080960 | RubberDandelionOmics

Gene overview

TkA05G080960

Reference: TK1151 Chr: Chr05 Coordinates: 21433133-21434265 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · TkA05G080960|TK1151|cDNA

ATGCAGCAACAAAAATTCCCAAAAGACCGCATAACTTTGATTGCTTTTTTAGTATTGTGGTTTCTTCTGCAAGCATCATTGATAACTGGAAATTTCACCATTGGTGTGATTCTTGATGAAACTTCTAGACCTGGAAAAGAGACAAAAGTTGCAATTGAGGTATCAATTCAAGATTTCAACATCAAAATTAGCAATCAGACTTCGGTTTTATATCTTCAAAACTCTCGAAGCAAGCCCCTTCATGCGGCTATTGCAGTAAA...

CDS

Download CDS FASTA

987 bp · TkA05G080960|TK1151|CDS

ATGCAGCAACAAAAATTCCCAAAAGACCGCATAACTTTGATTGCTTTTTTAGTATTGTGGTTTCTTCTGCAAGCATCATTGATAACTGGAAATTTCACCATTGGTGTGATTCTTGATGAAACTTCTAGACCTGGAAAAGAGACAAAAGTTGCAATTGAGGTATCAATTCAAGATTTCAACATCAAAATTAGCAATCAGACTTCGGTTTTATATCTTCAAAACTCTCGAAGCAAGCCCCTTCATGCGGCTATTGCAGTAAA...

Protein

Download Protein FASTA

328 aa · TkA05G080960|TK1151|PROTEIN

MQQQKFPKDRITLIAFLVLWFLLQASLITGNFTIGVILDETSRPGKETKVAIEVSIQDFNIKISNQTSVLYLQNSRSKPLHAAIAVKQLIDEHKVDAILGGHTWEEASAIAEVISEADQNIPVFLSLATTPQSTHMNAVAAILQSWGIRQVTLIYEASHLASTASIITYLSQAFRQTGCELNRILPLTSGMVGVKCYFPENKPDFRDFRKRFRQKFSFNYPHEEENEPGIFAVQGYNAVKLLEEILPENFVHKIAAPQSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G080960`
TK1151 ID	TkA05G080960
OH-1004 ID	LXL04_001944
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 91.463 / OH-1004 44.231 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G080960`
Location	Chr05:21433133-21434265 (-)
Description	Similar to GLR2.6: Glutamate receptor 2.6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001944` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006816 calcium ion transport Biological Process GO:0006874 intracellular calcium ion homeostasis Biological Process GO:0009416 response to light stimulus Biological Process GO:0019722 calcium-mediated signaling Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005262 calcium channel activity Molecular Function GO:0008066 glutamate receptor activity Molecular Function GO:0015276 ligand-gated monoatomic ion channel activity Molecular Function GO:0038023 signaling receptor activity Molecular Function
KEGG gene cross-reference	ath:AT2G24720 ath:AT2G29110 ath:AT2G29120 ath:AT5G11180 ath:AT5G27100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.339

Rank 1 · TkA05G080960 · TK1151

Cell membrane0.192

Rank 2 · TkA05G080960 · TK1151

Cytoplasm0.161

Rank 3 · TkA05G080960 · TK1151

Endoplasmic reticulum0.150

Rank 4 · TkA05G080960 · TK1151

Nucleus0.079

Rank 5 · TkA05G080960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458Peripla_BP_633-144 aa

PF01094ANF_receptor49-181 aa

PF04392ABC_sub_bind52-136 aa

PF13458Peripla_BP_6187-245 aa

PF01094ANF_receptor188-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G080960	`PF13458`	Peripla_BP_6	33	144	5.7e-12	46.7
TkA05G080960	`PF01094`	ANF_receptor	49	181	3.1e-11	43.7
TkA05G080960	`PF04392`	ABC_sub_bind	52	136	0.035	14.1
TkA05G080960	`PF13458`	Peripla_BP_6	187	245	5.7e-12	46.7
TkA05G080960	`PF01094`	ANF_receptor	188	242	3.1e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card