TkA05G074650 | RubberDandelionOmics

Gene overview

TkA05G074650

Reference: TK1151 Chr: Chr05 Coordinates: 19875082-19877641 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA05G074650|TK1151|cDNA

ATGCTCTTCCTTGTTCTTCTAGCATTGCTCTCGGTATCTACTTGCCATGCTCATAAAGAAGCCACGGTTCGCGAACTCAGGATCGCGTTTAACCAAAACCGAGTCACCTCAAGGCAACTCGTAGAGTTCTATCTTGGTGAGATCAAGAAACTCAACCCGGTTCTTAAAGGGGTCCTAGAAGTGAACCCTGATGCCCTATATGAGGCAGATAGAGCCGACAAGGAGCGGGCAGCAAATATGCCTCAGTCATTGGTCGGCTT...

CDS

Download CDS FASTA

1416 bp · TkA05G074650|TK1151|CDS

ATGCTCTTCCTTGTTCTTCTAGCATTGCTCTCGGTATCTACTTGCCATGCTCATAAAGAAGCCACGGTTCGCGAACTCAGGATCGCGTTTAACCAAAACCGAGTCACCTCAAGGCAACTCGTAGAGTTCTATCTTGGTGAGATCAAGAAACTCAACCCGGTTCTTAAAGGGGTCCTAGAAGTGAACCCTGATGCCCTATATGAGGCAGATAGAGCCGACAAGGAGCGGGCAGCAAATATGCCTCAGTCATTGGTCGGCTT...

Protein

Download Protein FASTA

471 aa · TkA05G074650|TK1151|PROTEIN

MLFLVLLALLSVSTCHAHKEATVRELRIAFNQNRVTSRQLVEFYLGEIKKLNPVLKGVLEVNPDALYEADRADKERAANMPQSLVGLHGIPVLLKDSIATKDKLNTTSGSFALLGSIVPRDAGIVSKLRKSGAIILGKASLSEWSNFRSLSAPSGWSPRGGQGKNPYVLSASPCGSSSGPAISVAANMAAVSIGTETDGSILCPASFNSVVGIKPTVGLTSRAGVIPVSPSLDTIGPICRTVSDAVYVLDTIVGFDYNDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G074650`
TK1151 ID	TkA05G074650
OH-1004 ID	LXL04_019678
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.900
Protein coverage (%)	TK1151 92.569 / OH-1004 41.719 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G074650

Location Chr05:19875082-19877641 (-)

Description Similar to At4g34880: Probable amidase At4g34880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34880`	Probable amidase At4g34880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004040 amidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

KEGG gene cross-reference

abe:ARB_02965

ath:AT4G34880

cac:CA_C2977

spo:2543104

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.459

Rank 1 · TkA05G074650 · TK1151

Cytoplasm0.146

Rank 2 · TkA05G074650 · TK1151

Lysosome / Vacuole0.126

Rank 3 · TkA05G074650 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA05G074650 · TK1151

Nucleus0.041

Rank 5 · TkA05G074650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425Amidase40-330 aa

PF01425Amidase413-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G074650	`PF01425`	Amidase	40	330	9.7e-74	249.7
TkA05G074650	`PF01425`	Amidase	413	450	9.7e-74	249.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8B760`	Arabidopsis thaliana	sp\|A0A1P8B760\|AMI4G_ARATH Probable amidase At4g34880	58.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card