TkA05G074510 | RubberDandelionOmics

Gene overview

TkA05G074510

Reference: TK1151 Chr: Chr05 Coordinates: 19834944-19835378 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA05G074510|TK1151|cDNA

ATGCAATTCTACTTCCACGATACTTTAAGCGGAAGTAATCCAAGTGCAATCCAAGTGGCTCAACCACAATCAAGCAGTAGGTCACTTGGTGGGTTCGGTAGCCTAATGATGGTTGATGACCCGTTGACCGAAGGACCAGACAAGAACTCCAAGCTCATTGGACATGCCCGTGGAATTATGGTCCTGAGTTATTGTTTTACTGATGGGATATATAAAGATAGTACATTTAGTCTTTTGAGTTTAAATCTTGCTATGCAGAC...

CDS

Download CDS FASTA

399 bp · TkA05G074510|TK1151|CDS

ATGCAATTCTACTTCCACGATACTTTAAGCGGAAGTAATCCAAGTGCAATCCAAGTGGCTCAACCACAATCAAGCAGTAGGTCACTTGGTGGGTTCGGTAGCCTAATGATGGTTGATGACCCGTTGACCGAAGGACCAGACAAGAACTCCAAGCTCATTGGACATGCCCGTGGAATTATGGTCCTGAGTTATTGTTTTACTGATGGGATATATAAAGATAGTACATTTAGTCTTTTGAGTTTAAATCTTGCTATGCAGAC...

Protein

Download Protein FASTA

132 aa · TkA05G074510|TK1151|PROTEIN

MQFYFHDTLSGSNPSAIQVAQPQSSSRSLGGFGSLMMVDDPLTEGPDKNSKLIGHARGIMVLSYCFTDGIYKDSTFSLLSLNLAMQTVREMTIVGGTGLFRLARGYALAQTYSINSSGDAVVGYNVTISTYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G074510`
TK1151 ID	TkA05G074510
OH-1004 ID	LXL04_019677
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.100
Protein coverage (%)	TK1151 93.182 / OH-1004 35.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G074510

Location Chr05:19834944-19835378 (-)

Description Similar to DIR23: Dirigent protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21100`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At5g42500`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At5g42510`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019677 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0048046 apoplast Cellular Component

GO:0140859 pterocarpan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G21100

gmx:100500621

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.521

Rank 1 · TkA05G074510 · TK1151

Lysosome / Vacuole0.222

Rank 2 · TkA05G074510 · TK1151

Endoplasmic reticulum0.109

Rank 3 · TkA05G074510 · TK1151

Cytoplasm0.108

Rank 4 · TkA05G074510 · TK1151

Cell membrane0.038

Rank 5 · TkA05G074510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03018Dirigent1-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G074510	`PF03018`	Dirigent	1	128	1.4e-41	142.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TH6`	Arabidopsis thaliana	sp\|Q84TH6\|DIR23_ARATH Dirigent protein 23	54.600%	Swiss-Prot	High
`Q9FIG7`	Arabidopsis thaliana	sp\|Q9FIG7\|DIR2_ARATH Dirigent protein 2	45.700%	Swiss-Prot	Medium
`Q9FIG6`	Arabidopsis thaliana	sp\|Q9FIG6\|DIR1_ARATH Dirigent protein 1	45.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card