TkA05G073730 | RubberDandelionOmics

Gene overview

TkA05G073730

Reference: TK1151 Chr: Chr05 Coordinates: 19641142-19647242 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1911 bp · TkA05G073730|TK1151|cDNA

TAGAGACATACTTACACACACAACTCTTCTCTTCCCTTTTATGTCTTTGTTCTTCTATAAATACATACATCACCCACCCACCATATCTTGTAGTTCCATTAATTAACTCCCAAGATAATTAATTTATATTTCCAGAAGTACCCATGGATGAAGGTCAAGAGAAGGTGGTGGAGACTGTGTTGGTAGGAAACTATGTGGAAATGGAGAGTGATGGCAAGGCTAAAAATGTCAAATCCACCATCTCCAACTTCTTCTGGAAT...

CDS

Download CDS FASTA

1491 bp · TkA05G073730|TK1151|CDS

ATGGATGAAGGTCAAGAGAAGGTGGTGGAGACTGTGTTGGTAGGAAACTATGTGGAAATGGAGAGTGATGGCAAGGCTAAAAATGTCAAATCCACCATCTCCAACTTCTTCTGGAATGGAGGTTCTGCTTATGATGCTTGGTTCAGTTGTTCTTCCAATCAGGTGGCTCAAGTGTTGCTTACACTACCATACTCATTTTCACAACTAGGAATGCTCTCAGGGATCTTGTTTCAAATCTTCTACGGTTTGATGGGCAGTTG...

Protein

Download Protein FASTA

496 aa · TkA05G073730|TK1151|PROTEIN

MDEGQEKVVETVLVGNYVEMESDGKAKNVKSTISNFFWNGGSAYDAWFSCSSNQVAQVLLTLPYSFSQLGMLSGILFQIFYGLMGSWTAYLISILYVEYRTRKEREKADFRNHVIQWFEVLDGLLGKHWRNVGLGFNCTFLLFGSVIQLIACASNIYYINDHLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLIMTTYTAWYLTIASILHGQVEGVKHTGPAKMVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G073730`
TK1151 ID	TkA05G073730
OH-1004 ID	LXL04_012280
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.100
Protein coverage (%)	TK1151 94.556 / OH-1004 98.323 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G073730

Location Chr05:19641142-19647242 (+)

Description Similar to LAX2: Auxin transporter-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21050`	Carrier protein involved in proton-driven auxin influx.	No verified direct reference in this release
`At1g77690`	Carrier protein involved in proton-driven auxin influx.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0147400`	Carrier protein involved in proton-driven auxin influx.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012280 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006865 amino acid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048829 root cap development Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G38120

dosa:Os01g0856500

mtr:11406709

mtr:11407085

mtr:25494399

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.730

Rank 1 · TkA05G073730 · TK1151

Cytoplasm0.118

Rank 2 · TkA05G073730 · TK1151

Endoplasmic reticulum0.094

Rank 3 · TkA05G073730 · TK1151

Lysosome / Vacuole0.089

Rank 4 · TkA05G073730 · TK1151

Golgi apparatus0.058

Rank 5 · TkA05G073730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans40-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G073730	`PF01490`	Aa_trans	40	432	1.3e-79	268.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S836`	Arabidopsis thaliana	sp\|Q9S836\|LAX2_ARATH Auxin transporter-like protein 2	87.700%	Swiss-Prot	High
`Q9CA25`	Arabidopsis thaliana	sp\|Q9CA25\|LAX3_ARATH Auxin transporter-like protein 3	83.700%	Swiss-Prot	High
`Q7XGU4`	Oryza sativa subsp. japonica	sp\|Q7XGU4\|LAX13_ORYSJ Auxin transporter-like protein 3	81.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card