TkA05G070880 | RubberDandelionOmics

Gene overview

TkA05G070880

Reference: TK1151 Chr: Chr05 Coordinates: 18938723-18939622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · TkA05G070880|TK1151|cDNA

AACATTCAACTCGATCATTTGAGGTATGTTGCAATATTGGGAACCTTCAAGGTTGTTCCTGCATCCATATCTAACCTTTGGAACCTACAAACTCTTGTTGTAGAGACAACGTTTCGTAACATTTATATTCAAGCGGATATTTGGAAATTGTTGAAGTTGAGGCATGTGTACACAAGTGCGGCTAGTGATTTGCCCACTCCATCTTCAAAATCACGAAAGAATGTTACAGATCCTTTGGTCAACAAAAACCTCATAACCTT...

CDS

Download CDS FASTA

804 bp · TkA05G070880|TK1151|CDS

AACATTCAACTCGATCATTTGAGGTATGTTGCAATATTGGGAACCTTCAAGGTTGTTCCTGCATCCATATCTAACCTTTGGAACCTACAAACTCTTGTTGTAGAGACAACGTTTCGTAACATTTATATTCAAGCGGATATTTGGAAATTGTTGAAGTTGAGGCATGTGTACACAAGTGCGGCTAGTGATTTGCCCACTCCATCTTCAAAATCACGAAAGAATGTTACAGATCCTTTGGTCAACAAAAACCTCATAACCTT...

Protein

Download Protein FASTA

267 aa · TkA05G070880|TK1151|PROTEIN

NIQLDHLRYVAILGTFKVVPASISNLWNLQTLVVETTFRNIYIQADIWKLLKLRHVYTSAASDLPTPSSKSRKNVTDPLVNKNLITLSKVSPNSCTDVILARTPNLRKLGVRGKLDTLLEEKKGSCKFDNIARLTHLENLKLFNDTYPTPPLDVIGKLEGLEVLKLGDNAFVGEHWEMREKSFTHLRVLQIGKTNLVHWEAASDQFPQLQRLSLKHCEQLAAMPCGLGDIPTLEVVELSWTSYSVVKSARLIKNKFKLLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G070880`
TK1151 ID	TkA05G070880
OH-1004 ID	LXL04_019647
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.900
Protein coverage (%)	TK1151 100.000 / OH-1004 34.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G070880`
Location	Chr05:18938723-18939622 (-)
Description	Similar to R1A-6: Putative late blight resistance protein homolog R1A-6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019647` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009626 plant-type hypersensitive response Biological Process GO:0051607 defense response to virus Biological Process GO:0005737 cytoplasm Cellular Component GO:0016020 membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · TkA05G070880 · TK1151

Nucleus0.413

Rank 2 · TkA05G070880 · TK1151

Cell membrane0.278

Rank 3 · TkA05G070880 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA05G070880 · TK1151

Extracellular0.031

Rank 5 · TkA05G070880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598LRR_144-66 aa

PF13855LRR_820-33 aa

PF12799LRR_423-34 aa

PF25019LRR_R13L1-DRL2124-54 aa

PF24758LRR_At5g5637092-111 aa

PF13855LRR_8102-109 aa

PF12799LRR_4102-112 aa

PF25019LRR_R13L1-DRL21123-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G070880	`PF23598`	LRR_14	4	66	2.2e-12	47.1
TkA05G070880	`PF13855`	LRR_8	20	33	0.00016	22.1
TkA05G070880	`PF12799`	LRR_4	23	34	0.0012	19.7
TkA05G070880	`PF25019`	LRR_R13L1-DRL21	24	54	4.8e-05	24.0
TkA05G070880	`PF24758`	LRR_At5g56370	92	111	0.023	15.1
TkA05G070880	`PF13855`	LRR_8	102	109	0.00016	22.1
TkA05G070880	`PF12799`	LRR_4	102	112	0.0012	19.7
TkA05G070880	`PF25019`	LRR_R13L1-DRL21	123	166	4.8e-05	24.0
TkA05G070880	`PF12799`	LRR_4	129	144	0.0012	19.7
TkA05G070880	`PF23598`	LRR_14	130	240	2.2e-12	47.1
TkA05G070880	`PF13855`	LRR_8	133	143	0.00016	22.1
TkA05G070880	`PF24758`	LRR_At5g56370	134	195	0.023	15.1
TkA05G070880	`PF12799`	LRR_4	153	169	0.0012	19.7
TkA05G070880	`PF13855`	LRR_8	155	170	0.00016	22.1
TkA05G070880	`PF13855`	LRR_8	160	217	0.00016	22.1
TkA05G070880	`PF12799`	LRR_4	161	195	0.0012	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card