TkA05G065600 | RubberDandelionOmics

Gene overview

TkA05G065600

Reference: TK1151 Chr: Chr05 Coordinates: 17511324-17513260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1675 bp · TkA05G065600|TK1151|cDNA

TTTTTGACACTTGCACAAGCAAGGACTTGGCAGCATGAAAAACCATATATATAGCGAGAGAGACATCAATTTCAAATATGGCTCCATACATACGTGTTGAAGCTATACCGCCTTCTAGTATGATTTGAATTCTCTCAGTAAGCAACACAGCATGAAGAAATCCAAACGAGCAAAGGCATCAAAACTCAAAGATGAGATCGATAGGATCAGTAACCTGCCAGATGACATTCTTTACCTGATTCTCGCAGGTCTTTCAAGCA...

CDS

Download CDS FASTA

1176 bp · TkA05G065600|TK1151|CDS

ATGTGCACATCATTTCCCTATTCCTCTATACGCATACGTTTTCCCCGAACGCTGAAAGCCCCAAGTAGATTCAAAATGAACAAATTCAACGAGTTTATGTCTAGGGTTTTGGTAAACGAGTCCCTCGATTTGGATGATTTGAGTTTACTTTGTCCAAATTACCACAATATGAGGACATTACGGCAGTGGATTGATGCAGCGGTTACGAGAAACGTCAAATTGATTCACGTGTTGGTTTGCCCTAAGAAGAAGTTCAAGGC...

Protein

Download Protein FASTA

391 aa · TkA05G065600|TK1151|PROTEIN

MCTSFPYSSIRIRFPRTLKAPSRFKMNKFNEFMSRVLVNESLDLDDLSLLCPNYHNMRTLRQWIDAAVTRNVKLIHVLVCPKKKFKAPHSLVNNGSLKVLRLFLFGRPLRLPYCTGLPSLRVVELNNLKVVDTNLEVFLNSCPLLEDLTLIDCWLIDGLLWISLPNLKNLRIDNKELDQHMSYYIWISCPKLVLWEVAGYVYHKFFIHNLDSLEKAVFHPQLLGLSKEEVVAEISNPGDLSLHIFLDQERPDSELDGPLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G065600`
TK1151 ID	TkA05G065600
OH-1004 ID	LXL04_026956
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.400
Protein coverage (%)	TK1151 97.954 / OH-1004 83.229 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G065600`
Location	Chr05:17511324-17513260 (+)
Description	Similar to At1g78760: Putative F-box/FBD/LRR-repeat protein At1g78760
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026956` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G66290 ath:AT1G66310 ath:AT1G69630 ath:AT1G78750 ath:AT1G78760 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.834

Rank 1 · TkA05G065600 · TK1151

Cytoplasm0.223

Rank 2 · TkA05G065600 · TK1151

Endoplasmic reticulum0.034

Rank 3 · TkA05G065600 · TK1151

Cell membrane0.033

Rank 4 · TkA05G065600 · TK1151

Plastid0.018

Rank 5 · TkA05G065600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF148-364 aa

PF24758LRR_At5g5637060-177 aa

PF08387FBD119-137 aa

PF08387FBD204-218 aa

PF24758LRR_At5g56370263-293 aa

PF08387FBD317-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G065600	`PF23622`	LRR_At1g61320_AtMIF1	48	364	6e-12	46.4
TkA05G065600	`PF24758`	LRR_At5g56370	60	177	6.2e-08	33.3
TkA05G065600	`PF08387`	FBD	119	137	6.7e-05	23.4
TkA05G065600	`PF08387`	FBD	204	218	6.7e-05	23.4
TkA05G065600	`PF24758`	LRR_At5g56370	263	293	6.2e-08	33.3
TkA05G065600	`PF08387`	FBD	317	354	6.7e-05	23.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card