Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2397 bp · TkA05G059590|TK1151|cDNA
GAAAATATTCCAAGGTTGCTTAGAAATGACCATAGAATGAGAACCGAACCCCAACTAGTGGGGCTATTTTTATCTTTTATAAAAAAAGAAGCTACGCACCAAGCTTCCTGGTACTTTCTACTTGTGCCAAATGATCTCAGAAAAAGACTCTACCGAATATCTTTGCGCGTCTTAAATTTAGCTTTCGCCATGTTCATCTTAATTGGGGCTTGTTGACCTTAAATAATCAAATATCGGTTGCAGGTCCAGTTCGTCGGAGA...
1167 bp · TkA05G059590|TK1151|CDS
ATGGCAGCAAATATCCCTTTGATTCCTGTTAACGAAAACCGCCCTCTTGTAGTTCCTACTCCAGTTAACACATTTTATCAGTTACCAGTTAAAAATCCTTGTGGAGATCTGCTTGCTGATGACAGAAGAAAAGACTACCTTGATATATGCATTCCTCTTTACGAGGCTTCAATGACCGGAAATTGGGCACATGCCAAAATCATCCTTGACGAACATCCAGAAGTAATCCGTTCCAGTATCACTGAAAATTACGAAACTGC...
Protein
Download Protein FASTA388 aa · TkA05G059590|TK1151|PROTEIN
MAANIPLIPVNENRPLVVPTPVNTFYQLPVKNPCGDLLADDRRKDYLDICIPLYEASMTGNWAHAKIILDEHPEVIRSSITENYETALHVAASAKNTHFVENLVKIMTKDDLELQNKNMNTALSLAAAAGTVDIAKVMVERNKGLLTIPGSQGMMPLYMAALFGNSEMVKYLYSKSQKLRDDGWTQKNRGWLLVKCVESDLFDVALDILKDFPDLGDDGQVLQVLARKPDAFRGTDPNLIRRIIHKISAVLDRTMGCAEN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G059590 |
|---|---|
| TK1151 ID | TkA05G059590 |
| OH-1004 ID | LXL04_032425 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 57.900 |
| Protein coverage (%) | TK1151 92.010 / OH-1004 55.455Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G059590 |
|---|---|
| Location | Chr05:15790137-15794169 (-) |
| Description | Similar to ANK3: Ankyrin-3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0002027 regulation of heart rate Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006874 intracellular calcium ion homeostasis Biological Process GO:0006897 endocytosis Biological Process GO:0007009 plasma membrane organization Biological Process GO:0007165 signal transduction Biological Process GO:0007528 neuromuscular junction development Biological Process GO:0008104 intracellular protein localization Biological Process GO:0009651 response to salt stress Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0010650 positive regulation of cell communication by electrical coupling Biological Process |
| KEGG gene cross-reference | ath:AT3G12360 hsa:287 hsa:288 mmu:109676 rno:361833 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08569Mo2541-213 aaPF12796Ank_252-104 aaPF13606Ank_352-72 aaPF00023Ank52-69 aaPF13637Ank_452-61 aaPF12796Ank_255-141 aaPF13637Ank_472-101 aaPF13857Ank_581-126 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G059590 | PF08569 | Mo25 | 41 | 213 | 0.033 | 14.2 |
| TkA05G059590 | PF12796 | Ank_2 | 52 | 104 | 3.6e-23 | 82.6 |
| TkA05G059590 | PF13606 | Ank_3 | 52 | 72 | 5.7e-12 | 45.3 |
| TkA05G059590 | PF00023 | Ank | 52 | 69 | 1.5e-11 | 44.6 |
| TkA05G059590 | PF13637 | Ank_4 | 52 | 61 | 1.5e-09 | 38.6 |
| TkA05G059590 | PF12796 | Ank_2 | 55 | 141 | 3.6e-23 | 82.6 |
| TkA05G059590 | PF13637 | Ank_4 | 72 | 101 | 1.5e-09 | 38.6 |
| TkA05G059590 | PF13857 | Ank_5 | 81 | 126 | 9.6e-10 | 39.3 |
| TkA05G059590 | PF13606 | Ank_3 | 84 | 105 | 5.7e-12 | 45.3 |
| TkA05G059590 | PF00023 | Ank | 85 | 104 | 1.5e-11 | 44.6 |
| TkA05G059590 | PF12796 | Ank_2 | 88 | 177 | 3.6e-23 | 82.6 |
| TkA05G059590 | PF13857 | Ank_5 | 112 | 141 | 9.6e-10 | 39.3 |
| TkA05G059590 | PF13637 | Ank_4 | 114 | 137 | 1.5e-09 | 38.6 |
| TkA05G059590 | PF13606 | Ank_3 | 120 | 141 | 5.7e-12 | 45.3 |
| TkA05G059590 | PF00023 | Ank | 120 | 140 | 1.5e-11 | 44.6 |
| TkA05G059590 | PF13857 | Ank_5 | 148 | 173 | 9.6e-10 | 39.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.