TkA05G058210 | RubberDandelionOmics

Gene overview

TkA05G058210

Reference: TK1151 Chr: Chr05 Coordinates: 15499388-15506703 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1722 bp · TkA05G058210|TK1151|cDNA

TTTTTCTTCAGAATCTTAGTTAGCCCTTCCACTTCCCATGTCCTCCCTCTATATTTATATTTATATACATCTACATATATAAGTAGGATTACAGAGAGAGAAACAAGAAACAACAACAACAGCAATGGGTGTATTTTTGTGTGATACCATGGTGTTAGTACTAGGATTCTCTACTTTCATCATGATTAATCATGTCTATATTGGATATGCATTTCCCCTTGACCGGGACTTTCAAACGCGTAAATTGCAAGAATTTAAGT...

CDS

Download CDS FASTA

1482 bp · TkA05G058210|TK1151|CDS

ATGGGTGTATTTTTGTGTGATACCATGGTGTTAGTACTAGGATTCTCTACTTTCATCATGATTAATCATGTCTATATTGGATATGCATTTCCCCTTGACCGGGACTTTCAAACGCGTAAATTGCAAGAATTTAAGTCATCATATTTCTTCCGACGAGAACACGTATCTCTTGCTTCATCATCTTCATCTCCCTCTCCATCTCCATCTCCATCTCCATCGTCTCCTGCAACAGTGGGGTCAGGAGTCTTTCCTGTGATTGC...

Protein

Download Protein FASTA

493 aa · TkA05G058210|TK1151|PROTEIN

MGVFLCDTMVLVLGFSTFIMINHVYIGYAFPLDRDFQTRKLQEFKSSYFFRREHVSLASSSSSPSPSPSPSPSSPATVGSGVFPVIAYGADPTGKNDSTDAILSAISDAVSGDGVGFLMHGIANLGGVHISLEGGIYKISRPIKFPVAGRGNILISGGTLKASDNFSTEGYMIDLSSPSSSPNSQYNYEYVTLRDLMLDCNFKGGGIRTINNLRISIDNCYITHFTTTGILVQSGHETYIRNCFLGQHITAGGDPGERNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058210`
TK1151 ID	TkA05G058210
OH-1004 ID	LXL04_019531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G058210

Location Chr05:15499388-15506703 (-)

Description Similar to QRT3: Polygalacturonase QRT3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20050`	Polygalacturonase required for degrading the pollen mother cell wall during microspore development.	Microspore separation in the quartet 3 mutants of Arabidopsis is impaired by a defect in a developmentally regulated polygalacturonase required for pollen mother cell wall degradation.2003 · DOI: 10.1104/pp.103.028266

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004650 polygalacturonase activity Molecular Function

KEGG gene cross-reference

ath:AT4G20050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.350

Rank 1 · TkA05G058210 · TK1151

Lysosome / Vacuole0.243

Rank 2 · TkA05G058210 · TK1151

Cytoplasm0.129

Rank 3 · TkA05G058210 · TK1151

Endoplasmic reticulum0.110

Rank 4 · TkA05G058210 · TK1151

Cell membrane0.070

Rank 5 · TkA05G058210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim85-314 aa

PF13229Beta_helix201-243 aa

PF13229Beta_helix263-385 aa

PF12708Pect-lyase_RHGA_epim369-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058210	`PF12708`	Pect-lyase_RHGA_epim	85	314	8.8e-07	29.6
TkA05G058210	`PF13229`	Beta_helix	201	243	0.00028	21.2
TkA05G058210	`PF13229`	Beta_helix	263	385	0.00028	21.2
TkA05G058210	`PF12708`	Pect-lyase_RHGA_epim	369	384	8.8e-07	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49432`	Arabidopsis thaliana	sp\|O49432\|QRT3_ARATH Polygalacturonase QRT3	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card