TkA05G058050 | RubberDandelionOmics

Gene overview

TkA05G058050

Reference: TK1151 Chr: Chr05 Coordinates: 15458036-15460183 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · TkA05G058050|TK1151|cDNA

TTTACTCATAAACCCAGTCTGGTAGTGTTCTGTTCGACCATCAGAATCGATCGGCTACGACCTACTGAGCAATATGAGGGGAATCTTCGCTATCCGTCGTATGGTACGTAATGGAGTTTATTGCGGCTCTATATGCTCTTCCATTGGTGAAATTGCATCAGTTTCCTCTTCAAATCCAGCAACAATTCCATATTCGTACTCGTACTCGTTCTCTTCTGTCACGAAACCATCGTGGTCTATTCCCATCTCCAAATTTCAAT...

CDS

Download CDS FASTA

576 bp · TkA05G058050|TK1151|CDS

ATGAGGGGAATCTTCGCTATCCGTCGTATGGTACGTAATGGAGTTTATTGCGGCTCTATATGCTCTTCCATTGGTGAAATTGCATCAGTTTCCTCTTCAAATCCAGCAACAATTCCATATTCGTACTCGTACTCGTTCTCTTCTGTCACGAAACCATCGTGGTCTATTCCCATCTCCAAATTTCAATCGGGGCAGCAGCCTTCCAATCGGAATCACTTTACCTCCTCCGCATCCAGTGGATCTAGAGTGGTAACAGTTGA...

Protein

Download Protein FASTA

191 aa · TkA05G058050|TK1151|PROTEIN

MRGIFAIRRMVRNGVYCGSICSSIGEIASVSSSNPATIPYSYSYSFSSVTKPSWSIPISKFQSGQQPSNRNHFTSSASSGSRVVTVESEDEFNSLLRKVQDESLPAVFYFTAVWCGPCRFVSPLIGELSEKYTNVTTYKIDIDQEGMRGALEKLNIAAVPTLHFFQGGKKVSEIVGADIQRLKTTMEDLYK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058050`
TK1151 ID	TkA05G058050
OH-1004 ID	LXL04_035515
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	36.600
Protein coverage (%)	TK1151 58.639 / OH-1004 28.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G058050

Location Chr05:15458036-15460183 (-)

Description Similar to TDX: TPR repeat-containing thioredoxin TDX

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35010`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At1g31020`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0665900`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`Os09g0401200`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035515 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0010286 heat acclimation Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0016667 oxidoreductase activity, acting on a sulfur group of donors Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

GO:0030544 Hsp70 protein binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G17880

ath:AT4G22670

dosa:Os09g0401200

gga:418003

osa:4346999

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.865

Rank 1 · TkA05G058050 · TK1151

Plastid0.121

Rank 2 · TkA05G058050 · TK1151

Cytoplasm0.066

Rank 3 · TkA05G058050 · TK1151

Nucleus0.055

Rank 4 · TkA05G058050 · TK1151

Cell membrane0.017

Rank 5 · TkA05G058050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13728TraF77-177 aa

PF00085Thioredoxin85-186 aa

PF14595Thioredoxin_985-165 aa

PF20207PedC-like95-178 aa

PF13098Thioredoxin_295-177 aa

PF00462Glutaredoxin107-162 aa

PF13905Thioredoxin_8107-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058050	`PF13728`	TraF	77	177	0.00016	22.4
TkA05G058050	`PF00085`	Thioredoxin	85	186	9.1e-19	68.1
TkA05G058050	`PF14595`	Thioredoxin_9	85	165	0.036	14.7
TkA05G058050	`PF20207`	PedC-like	95	178	0.00017	22.2
TkA05G058050	`PF13098`	Thioredoxin_2	95	177	0.00023	22.1
TkA05G058050	`PF00462`	Glutaredoxin	107	162	0.11	13.5
TkA05G058050	`PF13905`	Thioredoxin_8	107	136	0.24	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64764`	Arabidopsis thaliana	sp\|O64764\|TRXO1_ARATH Thioredoxin O1, mitochondrial	58.500%	Swiss-Prot	Medium
`Q93VQ9`	Arabidopsis thaliana	sp\|Q93VQ9\|TRXO2_ARATH Thioredoxin O2, mitochondrial	59.300%	Swiss-Prot	Medium
`Q655X0`	Oryza sativa subsp. japonica	sp\|Q655X0\|TRXO_ORYSJ Thioredoxin O, mitochondrial	49.200%	Swiss-Prot	Medium
`Q6ES52`	Oryza sativa subsp. japonica	sp\|Q6ES52\|TDX_ORYSJ TPR repeat-containing thioredoxin TDX	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card