TkA05G058030 | RubberDandelionOmics

Gene overview

TkA05G058030

Reference: TK1151 Chr: Chr05 Coordinates: 15451756-15455330 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1630 bp · TkA05G058030|TK1151|cDNA

AATCATGTCTAATTTTAGAAAAACTCTTTGTTGGCCGTTTAGGATTGGTAATGACTAATGACGAAACTAAACCATACCAGATGTGTCTGGCCATCGAGGAGTCTACTAAATCAGCATCCGCAAATCCATTACAATCCACAGTCTACTGTTGTGCACCATGGCTGCTCTTACCTTTGCTCACCACATCCTTTTCTCCAAACCCTCTGTCTTCCTTCACTCAACCAAAAACGGTGGTTTCAGTACCTTCTTCTCCGTCTCCG...

CDS

Download CDS FASTA

1281 bp · TkA05G058030|TK1151|CDS

ATGGCTGCTCTTACCTTTGCTCACCACATCCTTTTCTCCAAACCCTCTGTCTTCCTTCACTCAACCAAAAACGGTGGTTTCAGTACCTTCTTCTCCGTCTCCGCACCTTTCCTTCGCCGACACAAATCCACACAGACAATAGCGGCGGCTTCTTCACTCCTTGAACTTGGCGGAGTTAAAATCTCCAAAGAAGATGTGGTTAAAGATGAACCAACAAATAATGTCCCGGATTTGATTTTCACTAAACTTGGGCTGCAACT...

Protein

Download Protein FASTA

426 aa · TkA05G058030|TK1151|PROTEIN

MAALTFAHHILFSKPSVFLHSTKNGGFSTFFSVSAPFLRRHKSTQTIAAASSLLELGGVKISKEDVVKDEPTNNVPDLIFTKLGLQLHRRDHHPLGILKNTIYEYFDTNYENQFHKFDDLCPIVTTKENFDDVLVPADHVSRSYNDTYYIDQETVLRCHTSAHQADLLRKGYANFLVTGDVYRRDSIDSTHYPVFHQMEGVRVFSPSDWNDSGMDGTLYAAQDLKACLEGLARHLFGAVEMRWVDSYFPFTNPSFELEIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058030`
TK1151 ID	TkA05G058030
OH-1004 ID	LXL04_019529
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G058030

Location Chr05:15451756-15455330 (-)

Description Similar to At3g58140: Phenylalanine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58140`	Is responsible for the charging of tRNA(Phe) with phenylalanine in mitochondrial translation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019529 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006432 phenylalanyl-tRNA aminoacylation Biological Process

GO:0008033 tRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0004826 phenylalanine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G58140

ddi:DDB_G0274371

hsa:10667

mmu:69955

rno:306879

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.567

Rank 1 · TkA05G058030 · TK1151

Plastid0.451

Rank 2 · TkA05G058030 · TK1151

Cytoplasm0.102

Rank 3 · TkA05G058030 · TK1151

Nucleus0.060

Rank 4 · TkA05G058030 · TK1151

Peroxisome0.020

Rank 5 · TkA05G058030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29780CfpA_N66-117 aa

PF01409tRNA-synt_2d92-323 aa

PF03147FDX-ACB336-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058030	`PF29780`	CfpA_N	66	117	0.044	15.1
TkA05G058030	`PF01409`	tRNA-synt_2d	92	323	2.4e-50	172.0
TkA05G058030	`PF03147`	FDX-ACB	336	426	3.8e-21	76.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K73`	Arabidopsis thaliana	sp\|Q94K73\|SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card