TkA05G057570 | RubberDandelionOmics

Gene overview

TkA05G057570

Reference: TK1151 Chr: Chr05 Coordinates: 15317122-15320092 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1494 bp · TkA05G057570|TK1151|cDNA

AATTTACTCCTTCGGCAAACTCGTAATAAAAAACCTGGTTATATACGGCATAATCACTTGGCGTGTGTAATTTCGCATGTTGATCTCCAGTTGATCTTCTTACTCCCTACTCTAGGGTTTCTTCTTCACCCATTAATGGAATCTACTACTTCTTCACATGAGGTTCTGATATGTCAAACATGTGGTGACAAAGGATTCACCAATGCCTTTGTTTATTGTGTCAAATGTTTAGGATTTGTGGTTCACAGGTACTGCCTACA...

CDS

Download CDS FASTA

1287 bp · TkA05G057570|TK1151|CDS

AATTTACTCCTTCGGCAAACTCGTAATAAAAAACCTGGTTATATACGGCATAATCACTTGGCGTGTGTAATTTCGCATGTTGATCTCCAGTTGATCTTCTTACTCCCTACTCTAGGGTTTCTTCTTCACCCATTAATGGAATCTACTACTTCTTCACATGAGGTTCTGATATGTCAAACATGTGGTGACAAAGGATTCACCAATGCCTTTGTTTATTGTGTCAAATGTTTAGGATTTGTGGTTCACAGGTACTGCCTACA...

Protein

Download Protein FASTA

428 aa · TkA05G057570|TK1151|PROTEIN

NLLLRQTRNKKPGYIRHNHLACVISHVDLQLIFLLPTLGFLLHPLMESTTSSHEVLICQTCGDKGFTNAFVYCVKCLGFVVHRYCLHVITFDEFVHWVCEDCQQPLPFPSTSQSQKSNPKPNATTSPILKPSKRKKRSKIPKKKRKIAPFVEERKEEESQGGFKTFVLALEAQTKGEKERKIDENVEILKEDKSGKIGNSIEHSGCDSSCTNVDLKNKGAGIQEPEHETATQSTCLENNNNNNNNSNVDYIPYKPAKPHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G057570`
TK1151 ID	TkA05G057570
OH-1004 ID	LXL04_019515
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 92.991 / OH-1004 80.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G057570

Location Chr05:15317122-15320092 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43770`	Together with AIPP3/BDT1, cooperates to form a BAH-PHD bivalent histone reader complex able to read histone H3 lysine 27 trimethylation (H3K27me3) histone marks in order to regulate transcription, especially to prevent early flowering; promotes AIPP3/BDT1 binding to H3K27me3.	A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.2021 · DOI: 10.1111/jipb.13067

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019515 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0042393 histone binding Molecular Function

GO:0061628 histone H3K27me3 reader activity Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

ath:AT1G43770

ath:AT5G16680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA05G057570 · TK1151

Cytoplasm0.124

Rank 2 · TkA05G057570 · TK1151

Cell membrane0.034

Rank 3 · TkA05G057570 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA05G057570 · TK1151

Plastid0.012

Rank 5 · TkA05G057570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628PHD18-24 aa

PF03107C1_243-85 aa

PF08274Zn_Ribbon_YjdM47-62 aa

PF26054PHD_G2E349-66 aa

PF13831PHD_254-61 aa

PF00628PHD58-102 aa

PF25054PHD_pln61-100 aa

PF13831PHD_267-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G057570	`PF00628`	PHD	18	24	4.3	8.2
TkA05G057570	`PF03107`	C1_2	43	85	0.014	16.4
TkA05G057570	`PF08274`	Zn_Ribbon_YjdM	47	62	0.39	11.5
TkA05G057570	`PF26054`	PHD_G2E3	49	66	0.062	14.0
TkA05G057570	`PF13831`	PHD_2	54	61	3.9	7.8
TkA05G057570	`PF00628`	PHD	58	102	4.3	8.2
TkA05G057570	`PF25054`	PHD_pln	61	100	0.0068	17.0
TkA05G057570	`PF13831`	PHD_2	67	102	3.9	7.8
TkA05G057570	`PF26054`	PHD_G2E3	70	103	0.062	14.0
TkA05G057570	`PF03107`	C1_2	96	105	0.014	16.4
TkA05G057570	`PF08274`	Zn_Ribbon_YjdM	96	103	0.39	11.5
TkA05G057570	`PF23121`	SPOC_AIPP2	264	392	4e-45	153.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H578`	Arabidopsis thaliana	sp\|B3H578\|PHD1_ARATH PHD finger-containing protein 1	39.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card