TkA05G055180 | RubberDandelionOmics

Gene overview

TkA05G055180

Reference: TK1151 Chr: Chr05 Coordinates: 14662073-14666397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1795 bp · TkA05G055180|TK1151|cDNA

AGATACGTATGCTTAAAGTCGAAATTGAGAGGAGAGAGAAATGGATAGGATGTTTTCAGTGGACGATATCGCGGGCCACTTTTGGTCGCCATCGCCGGCCGCCGGCGCAGCCGACGAGGATGAATCGTCGTCTTCTTCATCCGCATCTAAGAGCAAGTCAACGCCGGCGATGATGAATCGGAGCATGTCGGAGTGGCAATTTCAACGCTTCCTCCAAGAAGCATCGGCACCACCGGAATCTACCTCCTATAGACCAAACG...

CDS

Download CDS FASTA

1359 bp · TkA05G055180|TK1151|CDS

ATGGATAGGATGTTTTCAGTGGACGATATCGCGGGCCACTTTTGGTCGCCATCGCCGGCCGCCGGCGCAGCCGACGAGGATGAATCGTCGTCTTCTTCATCCGCATCTAAGAGCAAGTCAACGCCGGCGATGATGAATCGGAGCATGTCGGAGTGGCAATTTCAACGCTTCCTCCAAGAAGCATCGGCACCACCGGAATCTACCTCCTATAGACCAAACGAAGTTGTCGAGATCAAGGATCAAGATGAGCTTCGAGAAAA...

Protein

Download Protein FASTA

452 aa · TkA05G055180|TK1151|PROTEIN

MDRMFSVDDIAGHFWSPSPAAGAADEDESSSSSSASKSKSTPAMMNRSMSEWQFQRFLQEASAPPESTSYRPNEVVEIKDQDELREKNQPSATTTATLKNNESGRTTGSSTGGGAAATTSFGASIAGGPPNVPIDSEEYQAYLKSRLNLACAAVALTRASSAKAQDFAGLTDNGSQASNTSQLGYQVPSKGFDPKGASKDGGGPIGIPSLPAVQKKVAAIPVKSATSGSSRELSDDDELDGDTETTQNMDPTDAKRVRRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G055180`
TK1151 ID	TkA05G055180
OH-1004 ID	LXL04_019474
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 99.115 / OH-1004 96.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G055180

Location Chr05:14662073-14666397 (+)

Description Similar to CPRF2: Light-inducible protein CPRF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28770`	Transcription factor involved in controlling responses to starvation.	SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.2015 · DOI: 10.7554/elife.05828
`At4g02640`	Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters.	Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.2003 · DOI: 10.1074/jbc.m210538200 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.2006 · DOI: 10.1038/sj.emboj.7601206 bZIP10-LSD1 antagonism modulates basal defense and cell death in Arabidopsis following infection.2006 · DOI: 10.1038/sj.emboj.7601312 A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.2009 · DOI: 10.1104/pp.109.136531 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968
`At3g54620`	Transcription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g.	Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.2003 · DOI: 10.1074/jbc.m210538200 A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.2009 · DOI: 10.1104/pp.109.136531 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0796900`	Transcriptional activator that binds to the DNA specific sequence 5'-GCCACGT[AC]AG-3' found in the alpha-globulin gene promoter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071333 cellular response to glucose stimulus Biological Process

GO:2000693 positive regulation of seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G54620

ath:AT4G02640

ath:AT5G28770

dosa:Os03g0796900

osa:4334424

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA05G055180 · TK1151

Cytoplasm0.086

Rank 2 · TkA05G055180 · TK1151

Cell membrane0.030

Rank 3 · TkA05G055180 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA05G055180 · TK1151

Plastid0.010

Rank 5 · TkA05G055180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12498bZIP_C45-49 aa

PF00170bZIP_184-99 aa

PF12498bZIP_C130-171 aa

PF26095CC_Bre1135-161 aa

PF07200Mod_r233-333 aa

PF07716bZIP_2252-301 aa

PF03131bZIP_Maf253-309 aa

PF00170bZIP_1254-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G055180	`PF12498`	bZIP_C	45	49	1.9e-34	120.0
TkA05G055180	`PF00170`	bZIP_1	84	99	6.3e-14	52.5
TkA05G055180	`PF12498`	bZIP_C	130	171	1.9e-34	120.0
TkA05G055180	`PF26095`	CC_Bre1	135	161	9.6	7.2
TkA05G055180	`PF07200`	Mod_r	233	333	0.47	11.2
TkA05G055180	`PF07716`	bZIP_2	252	301	2.8e-08	34.4
TkA05G055180	`PF03131`	bZIP_Maf	253	309	0.00071	20.8
TkA05G055180	`PF00170`	bZIP_1	254	306	6.3e-14	52.5
TkA05G055180	`PF09789`	CC149	255	333	0.0016	18.5
TkA05G055180	`PF19220`	Rod_CreS	255	336	0.011	15.6
TkA05G055180	`PF13863`	DUF4200	256	302	0.3	12.1
TkA05G055180	`PF24161`	CCDC39	257	334	0.016	13.8
TkA05G055180	`PF26095`	CC_Bre1	257	310	9.6	7.2
TkA05G055180	`PF25762`	HAUS1	260	336	0.13	12.7
TkA05G055180	`PF07926`	TPR_MLP1_2	262	335	3.8	8.3
TkA05G055180	`PF25450`	Rab11-FIP3	263	337	0.012	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGI8`	Arabidopsis thaliana	sp\|B9DGI8\|BZP63_ARATH Basic leucine zipper 63	40.000%	Swiss-Prot	Medium
`O22763`	Arabidopsis thaliana	sp\|O22763\|BZP10_ARATH Basic leucine zipper 10	36.800%	Swiss-Prot	Medium
`Q9M1G6`	Arabidopsis thaliana	sp\|Q9M1G6\|BZP25_ARATH Basic leucine zipper 25	42.600%	Swiss-Prot	Medium
`Q7X9A8`	Oryza sativa subsp. japonica	sp\|Q7X9A8\|RSBZ2_ORYSJ bZIP transcription factor RISBZ2	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card