TkA05G052460 | RubberDandelionOmics

Gene overview

TkA05G052460

Reference: TK1151 Chr: Chr05 Coordinates: 13980785-13983908 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1750 bp · TkA05G052460|TK1151|cDNA

GTAATCTCAAGCAATATTGTAGGGATGTTTATTGTAACTTCGCTTCAACTCATTTCAACCATCATCACCAAAACACGGGTCTAAAATAGTCCGGCAATCAACCGGGGGAAGATGGCCTTTCCCTCCTCTTCTCCCTTCCTCAGCTGCCATGGCAGCACCTCTCCCTCCACCACTTCCTCTTATTTTCCTTCCTTACCTACCACCTACCTCCGCCGCCACCGAGGTGTCACCAAAAACCACATCCCCTCCTCTTCTACTTC...

CDS

Download CDS FASTA

1305 bp · TkA05G052460|TK1151|CDS

ATGGCCTTTCCCTCCTCTTCTCCCTTCCTCAGCTGCCATGGCAGCACCTCTCCCTCCACCACTTCCTCTTATTTTCCTTCCTTACCTACCACCTACCTCCGCCGCCACCGAGGTGTCACCAAAAACCACATCCCCTCCTCTTCTACTTCTACATCTAAACCTCTACTATCACCTTTACCACCACACCCGCCACTCCCGTTAACTGTCATCAAAACTTCCGCAAATCACACCTACATCTCCTTCAAAACCAAGTCTTCCGA...

Protein

Download Protein FASTA

434 aa · TkA05G052460|TK1151|PROTEIN

MAFPSSSPFLSCHGSTSPSTTSSYFPSLPTTYLRRHRGVTKNHIPSSSTSTSKPLLSPLPPHPPLPLTVIKTSANHTYISFKTKSSDSDTQFNTLSSPPSSEIDCVGTGTDVECVVPSEGKGDYEITEPETSSLIETIWEWTLLVSPFFFWGTAMVAMKEVLPKTGPLFISSFRLIPSGFLLVAFAASRGRKMPSGLNAWLSIALFALVDATCFQGFLAKGLEKTSAGLGSVIIDSQPLTVAILASFLFGETIGLVGIAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G052460`
TK1151 ID	TkA05G052460
OH-1004 ID	LXL04_019449
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.926 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G052460

Location Chr05:13980785-13983908 (-)

Description Similar to At3g02690: WAT1-related protein At3g02690, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02690`	WAT1-related protein At3g02690, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019449 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

afu:AF_0510

ath:AT3G02690

bsu:BSU18770

bsu:BSU34000

syn:sll0355

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.988

Rank 1 · TkA05G052460 · TK1151

Peroxisome0.017

Rank 2 · TkA05G052460 · TK1151

Cytoplasm0.015

Rank 3 · TkA05G052460 · TK1151

Mitochondrion0.015

Rank 4 · TkA05G052460 · TK1151

Nucleus0.014

Rank 5 · TkA05G052460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA143-271 aa

PF03151TPT156-279 aa

PF24282DUF7470251-271 aa

PF00892EamA288-428 aa

PF24282DUF7470313-336 aa

PF24282DUF7470415-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G052460	`PF00892`	EamA	143	271	3.6e-46	157.5
TkA05G052460	`PF03151`	TPT	156	279	0.054	13.6
TkA05G052460	`PF24282`	DUF7470	251	271	0.48	11.0
TkA05G052460	`PF00892`	EamA	288	428	3.6e-46	157.5
TkA05G052460	`PF24282`	DUF7470	313	336	0.48	11.0
TkA05G052460	`PF24282`	DUF7470	415	432	0.48	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V85`	Arabidopsis thaliana	sp\|Q93V85\|WTR16_ARATH WAT1-related protein At3g02690, chloroplastic	68.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card