TkA05G049400 | RubberDandelionOmics

Gene overview

TkA05G049400

Reference: TK1151 Chr: Chr05 Coordinates: 13036969-13039209 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1841 bp · TkA05G049400|TK1151|cDNA

AGGACTTCTTGAATCTTGATTCTTTAAGTGTTTTTAATGAAGGGAAAACTCTCGTTGAAAACATCTTGAAAGTCAAAATGAACGGAAGAACGGGACCCATCGAGTTCACTTCTGATAAAAACCTCGTTTTTCTGGCATTCGAAGTTATTAACGTGATCGGAACAGGGTTTCGGAGAGTCGGGTATTGGTCAAATTATTCACGTCTTTCAACTACTCCTCCAGAAATAGTCAACAAGAACCAATCTAATTCATCGGAGCTA...

CDS

Download CDS FASTA

1743 bp · TkA05G049400|TK1151|CDS

ATGAACGGAAGAACGGGACCCATCGAGTTCACTTCTGATAAAAACCTCGTTTTTCTGGCATTCGAAGTTATTAACGTGATCGGAACAGGGTTTCGGAGAGTCGGGTATTGGTCAAATTATTCACGTCTTTCAACTACTCCTCCAGAAATAGTCAACAAGAACCAATCTAATTCATCGGAGCTATTGCATAGTGTGATTTGGCCGGGAGAAACCGGTAAAACACCTCGCGGATGGGCTTTCCCGGAGAAAGGAAAGCAGTT...

Protein

Download Protein FASTA

580 aa · TkA05G049400|TK1151|PROTEIN

MNGRTGPIEFTSDKNLVFLAFEVINVIGTGFRRVGYWSNYSRLSTTPPEIVNKNQSNSSELLHSVIWPGETGKTPRGWAFPEKGKQLKIGVPVRVSFQDFVEEAKGTDTYVGYSIDVFMSAIKLLPYAVPYKFYSYGDGKKNPAYTDLISLVNAGVYDAAVGDIAIISNRTRMADFTQPYIESGLVVVAPVRRVSSGTWAFFRPFTAELWCVIGICFLVVGAVVWILEHRRNDEFRGTPRHQVVTTLWFSFSTLFFSHKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G049400`
TK1151 ID	TkA05G049400
OH-1004 ID	LXL04_019404
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.400
Protein coverage (%)	TK1151 92.241 / OH-1004 58.542 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G049400

Location Chr05:13036969-13039209 (+)

Description Similar to GLR3.6: Glutamate receptor 3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g42540`	Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in roots and hypocotyls (Probable).	Calcium entry mediated by GLR3.3, an Arabidopsis glutamate receptor with a broad agonist profile.2006 · DOI: 10.1104/pp.106.088989 Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134 Glutamate receptor-like channel3.3 is involved in mediating glutathione-triggered cytosolic calcium transients, transcriptional changes, and innate immunity responses in Arabidopsis.2013 · DOI: 10.1104/pp.113.217208 Involvement of the glutamate receptor AtGLR3.3 in plant defense signaling and resistance to Hyaloperonospora arabidopsidis.2013 · DOI: 10.1111/tpj.12311 GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478 Real-time, in vivo intracellular recordings of caterpillar-induced depolarization waves in sieve elements using aphid electrodes.2014 · DOI: 10.1111/nph.12807
`At3g51480`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478
`At4g35290`	Glutamate-gated receptor that probably acts as a non-selective cation channel (Probable).	Overexpression of the AtGluR2 gene encoding an Arabidopsis homolog of mammalian glutamate receptors impairs calcium utilization and sensitivity to ionic stress in transgenic plants.2001 · DOI: 10.1093/pcp/pce008 Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668
`At2g17260`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	De-regulated expression of the plant glutamate receptor homolog AtGLR3.1 impairs long-term Ca2+-programmed stomatal closure.2009 · DOI: 10.1111/j.1365-313x.2009.03789.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0585200`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	A rice glutamate receptor-like gene is critical for the division and survival of individual cells in the root apical meristem.2006 · DOI: 10.1105/tpc.105.037713

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019404 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009630 gravitropism Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G05200

ath:AT1G42540

ath:AT3G51480

ath:AT4G35290

osa:124544569

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.715

Rank 1 · TkA05G049400 · TK1151

Endoplasmic reticulum0.102

Rank 2 · TkA05G049400 · TK1151

Lysosome / Vacuole0.098

Rank 3 · TkA05G049400 · TK1151

Cytoplasm0.080

Rank 4 · TkA05G049400 · TK1151

Golgi apparatus0.044

Rank 5 · TkA05G049400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10613Lig_chan-Glu_bd102-189 aa

PF00497SBP_bac_3143-427 aa

PF00060Lig_chan207-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G049400	`PF10613`	Lig_chan-Glu_bd	102	189	2.9e-07	31.3
TkA05G049400	`PF00497`	SBP_bac_3	143	427	1.4e-09	38.5
TkA05G049400	`PF00060`	Lig_chan	207	460	2.2e-36	125.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8E7`	Arabidopsis thaliana	sp\|Q9C8E7\|GLR33_ARATH Glutamate receptor 3.3	55.300%	Swiss-Prot	High
`Q84W41`	Arabidopsis thaliana	sp\|Q84W41\|GLR36_ARATH Glutamate receptor 3.6	57.800%	Swiss-Prot	High
`Q93YT1`	Arabidopsis thaliana	sp\|Q93YT1\|GLR32_ARATH Glutamate receptor 3.2	52.800%	Swiss-Prot	High
`Q7XJL2`	Arabidopsis thaliana	sp\|Q7XJL2\|GLR31_ARATH Glutamate receptor 3.1	53.200%	Swiss-Prot	High
`Q7XP59`	Oryza sativa subsp. japonica	sp\|Q7XP59\|GLR31_ORYSJ Glutamate receptor 3.1	53.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card