TkA05G049270 | RubberDandelionOmics

Gene overview

TkA05G049270

Reference: TK1151 Chr: Chr05 Coordinates: 12991640-12992107 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA05G049270|TK1151|cDNA

ATGGCGTCTTTGAAGGAGATCCTGATGAGGCAACCGGTGGCAGCAACCATCCGGCTCACCATCCCTGCCGGCGCCGCTAGGCCAGGACCACCTGTTGGTCCAGCCATAGGTCAATATAAATTAAACCTAATGGCATTCTGCAAAGATTTCAATTCCCGAACACAAAAATTCAAGCCCGATACCCCAATTGCCGCCACCGTCATTGTCTTCAAAGATCACACATTTGAGCTTACCATCCGATCGCCGTCTGTAACATGGTA...

CDS

Download CDS FASTA

468 bp · TkA05G049270|TK1151|CDS

ATGGCGTCTTTGAAGGAGATCCTGATGAGGCAACCGGTGGCAGCAACCATCCGGCTCACCATCCCTGCCGGCGCCGCTAGGCCAGGACCACCTGTTGGTCCAGCCATAGGTCAATATAAATTAAACCTAATGGCATTCTGCAAAGATTTCAATTCCCGAACACAAAAATTCAAGCCCGATACCCCAATTGCCGCCACCGTCATTGTCTTCAAAGATCACACATTTGAGCTTACCATCCGATCGCCGTCTGTAACATGGTA...

Protein

Download Protein FASTA

155 aa · TkA05G049270|TK1151|PROTEIN

MASLKEILMRQPVAATIRLTIPAGAARPGPPVGPAIGQYKLNLMAFCKDFNSRTQKFKPDTPIAATVIVFKDHTFELTIRSPSVTWYLKQAAGITSGSRMPGHVVASSLTLKHIYEIAKVKQSDPYCQYMSLEAISKSIIGTANSMGIKVVKELD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G049270`
TK1151 ID	TkA05G049270
OH-1004 ID	LXL04_019401
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G049270`
Location	Chr05:12991640-12992107 (-)
Description	Similar to MRPL11: 39S ribosomal protein L11, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019401` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0006417 regulation of translation Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0032543 mitochondrial translation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005761 mitochondrial ribosome Cellular Component GO:0005762 mitochondrial large ribosomal subunit Cellular Component GO:0022625 cytosolic large ribosomal subunit Cellular Component GO:0003723 RNA binding Molecular Function GO:0003735 structural constituent of ribosome Molecular Function
KEGG gene cross-reference	bta:515990 dme:Dmel_CG3351 hsa:65003 rpc:RPC_3472 spo:2541549 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.675

Rank 1 · TkA05G049270 · TK1151

Cytoplasm0.215

Rank 2 · TkA05G049270 · TK1151

Nucleus0.104

Rank 3 · TkA05G049270 · TK1151

Plastid0.026

Rank 4 · TkA05G049270 · TK1151

Cell membrane0.012

Rank 5 · TkA05G049270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03946Ribosomal_L11_N17-75 aa

PF00298Ribosomal_L1181-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G049270	`PF03946`	Ribosomal_L11_N	17	75	1.6e-21	76.5
TkA05G049270	`PF00298`	Ribosomal_L11	81	150	1.3e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card