TkA05G046290 | RubberDandelionOmics

Gene overview

TkA05G046290

Reference: TK1151 Chr: Chr05 Coordinates: 12207409-12211012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3055 bp · TkA05G046290|TK1151|cDNA

CAAAAAGTAGCATTCCATTTCCATCACTCTCTATGAAAACTAAACGTGCTCCCCAATCTTTATATCCTTAAACATATAAATGCAACTTCAATACAACGAGATTTTTGCAAAATATGGATAGACAAACATCAATAGAAAGCCAAGGAAGCATCAATATTCCAATCCACGAGCTTACTGCCCAATTAAGCCGAATCCCCGCCATTTTCGAGCCACAAAGCAGCATCGAAACAACAACCAGCAATGAGAATACACCATCAGTT...

CDS

Download CDS FASTA

2526 bp · TkA05G046290|TK1151|CDS

ATGGATAGACAAACATCAATAGAAAGCCAAGGAAGCATCAATATTCCAATCCACGAGCTTACTGCCCAATTAAGCCGAATCCCCGCCATTTTCGAGCCACAAAGCAGCATCGAAACAACAACCAGCAATGAGAATACACCATCAGTTTCCGGGAGAAGACTAGTGAACCGTGCACCGGAGAAGAACCTGACTCTTTTCGCCCTCCGGCTAGCGGTTCTTGAGAAAGCCGCCACCGGGCTAGGAACCCTCGGATTCATCTG...

Protein

Download Protein FASTA

841 aa · TkA05G046290|TK1151|PROTEIN

MDRQTSIESQGSINIPIHELTAQLSRIPAIFEPQSSIETTTSNENTPSVSGRRLVNRAPEKNLTLFALRLAVLEKAATGLGTLGFIWATVVLLGGFAITIDQTDFWFITIILLIEGTRIFSRSHELEWQHQATWSLTDAGISSFRAVKSRSHIIIRACKAVFGYGGSREIKQSSRLRNVKDRNLEKKTTLNRTWTSSDVPLLPYGQWVFLSKNISRLLYWLQLASATACVVLSLIKLVKQNFGEIEKGDTDKRNRKSALI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G046290`
TK1151 ID	TkA05G046290
OH-1004 ID	LXL04_019364
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G046290`
Location	Chr05:12207409-12211012 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019364` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.683

Rank 1 · TkA05G046290 · TK1151

Cytoplasm0.155

Rank 2 · TkA05G046290 · TK1151

Nucleus0.144

Rank 3 · TkA05G046290 · TK1151

Endoplasmic reticulum0.109

Rank 4 · TkA05G046290 · TK1151

Lysosome / Vacuole0.047

Rank 5 · TkA05G046290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17250NDUFB11175-220 aa

PF22534RFC_C282-334 aa

PF21052EFR3_ARM337-361 aa

PF14852Fis1_TPR_N341-359 aa

PF04652Vta1359-397 aa

PF21052EFR3_ARM373-446 aa

PF02985HEAT392-407 aa

PF17250NDUFB11455-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G046290	`PF17250`	NDUFB11	175	220	0.12	13.7
TkA05G046290	`PF22534`	RFC_C	282	334	0.076	14.3
TkA05G046290	`PF21052`	EFR3_ARM	337	361	0.12	11.7
TkA05G046290	`PF14852`	Fis1_TPR_N	341	359	0.24	11.8
TkA05G046290	`PF04652`	Vta1	359	397	0.056	14.1
TkA05G046290	`PF21052`	EFR3_ARM	373	446	0.12	11.7
TkA05G046290	`PF02985`	HEAT	392	407	0.22	12.6
TkA05G046290	`PF17250`	NDUFB11	455	470	0.12	13.7
TkA05G046290	`PF14852`	Fis1_TPR_N	463	476	0.24	11.8
TkA05G046290	`PF14852`	Fis1_TPR_N	562	576	0.24	11.8
TkA05G046290	`PF02985`	HEAT	609	623	0.22	12.6
TkA05G046290	`PF22534`	RFC_C	652	663	0.076	14.3
TkA05G046290	`PF04652`	Vta1	687	764	0.056	14.1
TkA05G046290	`PF17250`	NDUFB11	694	719	0.12	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card