TkA05G046240 | RubberDandelionOmics

Gene overview

TkA05G046240

Reference: TK1151 Chr: Chr05 Coordinates: 12195510-12196015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA05G046240|TK1151|cDNA

ATGGTCGAACCTCAGTTTTGGTGTTGGCCACCTGAATTTGAAAGTAACAAAAAAGAAAATGACACAACATTAGTTACCGAGGAAGAGGATGCATTTGGAAAACAAGTGTTGCTGTCAAGTGAAATTGTGGACTCTATATGCAGGGAAGTTGAACATAACAAAAATAGAAATGTTGCATCATTGATTACCGACGAAGATGATGCTTTTGAAAGACAAGTGTGGCTGTCAAGTGAAATTGTGGACTGCATATGCACGGCAGA...

CDS

Download CDS FASTA

336 bp · TkA05G046240|TK1151|CDS

ATGGTCGAACCTCAGTTTTGGTGTTGGCCACCTGAATTTGAAAGTAACAAAAAAGAAAATGACACAACATTAGTTACCGAGGAAGAGGATGCATTTGGAAAACAAGTGTTGCTGTCAAGTGAAATTGTGGACTCTATATGCAGGGAAGTTGAACATAACAAAAATAGAAATGTTGCATCATTGATTACCGACGAAGATGATGCTTTTGAAAGACAAGTGTGGCTGTCAAGTGAAATTGTGGACTGCATATGCACGGCAGA...

Protein

Download Protein FASTA

111 aa · TkA05G046240|TK1151|PROTEIN

MVEPQFWCWPPEFESNKKENDTTLVTEEEDAFGKQVLLSSEIVDSICREVEHNKNRNVASLITDEDDAFERQVWLSSEIVDCICTADTSVYFAIVGKESIQLNMKKFKSGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G046240`
TK1151 ID	TkA05G046240
OH-1004 ID	LXL04_001222
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.800
Protein coverage (%)	TK1151 100.000 / OH-1004 23.022 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G046240`
Location	Chr05:12195510-12196015 (+)
Description	Similar to Anthocyanin 3'-O-beta-glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001222` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008202 steroid metabolic process Biological Process GO:0010294 abscisic acid glucosyltransferase activity Molecular Function GO:0033837 anthocyanin 3'-O-beta-glucosyltransferase activity Molecular Function GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0050275 scopoletin glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:BAB83692 ag:BAC54092 var:108341782 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · TkA05G046240 · TK1151

Nucleus0.473

Rank 2 · TkA05G046240 · TK1151

Cell membrane0.082

Rank 3 · TkA05G046240 · TK1151

Mitochondrion0.066

Rank 4 · TkA05G046240 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA05G046240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26506DUF857429-92 aa

PF13043DUF390332-48 aa

PF20826PHD_540-53 aa

PF13742tRNA_anti_255-106 aa

PF20826PHD_564-98 aa

PF13043DUF390371-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G046240	`PF26506`	DUF8574	29	92	0.075	13.0
TkA05G046240	`PF13043`	DUF3903	32	48	0.12	13.0
TkA05G046240	`PF20826`	PHD_5	40	53	0.12	13.1
TkA05G046240	`PF13742`	tRNA_anti_2	55	106	0.03	15.3
TkA05G046240	`PF20826`	PHD_5	64	98	0.12	13.1
TkA05G046240	`PF13043`	DUF3903	71	81	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card