TkA05G038890 | RubberDandelionOmics

Gene overview

TkA05G038890

Reference: TK1151 Chr: Chr05 Coordinates: 10528507-10530161 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

749 bp · TkA05G038890|TK1151|cDNA

TTAAGCTTATTTTTCATGGCCCATGGAGTAAAGCTCTAAAATAACAAAACATCCCCTCTCCACAAAACCCTAGATTGAAGATTAGCGGCACAGCAGAAGCAGGCTTCCCCTCGCCGAAACCACACAGGATCTCCACACGATGACTTTCAAGCGAAGGAACGGAGGACGCAACAAGCACGGCCGTGGACACGTCAAGTTCATTCGTTGTTCTAACTGCGGAAAATGTTGCCCTAAGGACAAAGCTATTAAGAGATTTCTTG...

CDS

Download CDS FASTA

387 bp · TkA05G038890|TK1151|CDS

ATGACTTTCAAGCGAAGGAACGGAGGACGCAACAAGCACGGCCGTGGACACGTCAAGTTCATTCGTTGTTCTAACTGCGGAAAATGTTGCCCTAAGGACAAAGCTATTAAGAGATTTCTTGTAAGGAACATAGTGGAGCAAGCTGCAGTTAGGGATGTTCAAGAAGCTTGTGCCTTTGAGCAGTATACACTTCCGAAGCTGTACGTGAAGATGCAATACTGTGTCTCGTGTGCAATTCACTCAAAGGTTGTTAGGGTCCG...

Protein

Download Protein FASTA

128 aa · TkA05G038890|TK1151|PROTEIN

MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACAFEQYTLPKLYVKMQYCVSCAIHSKVVRVRSRVDRRNREPPKRFSRPRDDGPKPGQAPRPGVGAGPAPVRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G038890`
TK1151 ID	TkA05G038890
OH-1004 ID	LXL04_031806
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G038890

Location Chr05:10528507-10530161 (-)

Description Similar to RPS26A: 40S ribosomal protein S26-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56340`	Small ribosomal subunit protein eS26x.	No verified direct reference in this release
`At2g40590`	Small ribosomal subunit protein eS26y.	No verified direct reference in this release
`At2g40510`	Small ribosomal subunit protein eS26z.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0823300`	Small ribosomal subunit protein eS26.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031806 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0015935 small ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G40510

ath:AT2G40590

ath:AT3G56340

cel:CELE_F39B2.6

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.864

Rank 1 · TkA05G038890 · TK1151

Nucleus0.236

Rank 2 · TkA05G038890 · TK1151

Endoplasmic reticulum0.092

Rank 3 · TkA05G038890 · TK1151

Mitochondrion0.021

Rank 4 · TkA05G038890 · TK1151

Cell membrane0.011

Rank 5 · TkA05G038890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01283Ribosomal_S26e1-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G038890	`PF01283`	Ribosomal_S26e	1	103	3.8e-53	179.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYK9`	Arabidopsis thaliana	sp\|Q9LYK9\|RS263_ARATH Small ribosomal subunit protein eS26x	78.100%	Swiss-Prot	High
`P49206`	Arabidopsis thaliana	sp\|P49206\|RS261_ARATH Small ribosomal subunit protein eS26y	77.500%	Swiss-Prot	High
`Q8LPJ7`	Arabidopsis thaliana	sp\|Q8LPJ7\|RS262_ARATH Small ribosomal subunit protein eS26z	78.400%	Swiss-Prot	High
`P49216`	Oryza sativa subsp. japonica	sp\|P49216\|RS26_ORYSJ Small ribosomal subunit protein eS26	73.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card