TkA05G038700 | RubberDandelionOmics

Gene overview

TkA05G038700

Reference: TK1151 Chr: Chr05 Coordinates: 10496715-10499063 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA05G038700|TK1151|cDNA

ATGGGACTCCAACTCAAGACAAAGTCTTCATCCTTTTCTATCCTTCTCATCGTAACCGTTTGTGTTCTTCTACCAACTCCGGCTTTAGCTTTTGGATTCGGATTACGTGCTGCCAAAGTTCATGATCATGACCTCTGCTTCAAGGGAAAAGAAGAGATGATAAGATCGAACATGAACACCATGCGGAGGCGGATGCTGAGTGGCCTTGGCTCATCACCCCCACGGTGTGCATGGAAGTGTGGGCAGTGTACCCCTTGCAG...

CDS

Download CDS FASTA

525 bp · TkA05G038700|TK1151|CDS

ATGGGACTCCAACTCAAGACAAAGTCTTCATCCTTTTCTATCCTTCTCATCGTAACCGTTTGTGTTCTTCTACCAACTCCGGCTTTAGCTTTTGGATTCGGATTACGTGCTGCCAAAGTTCATGATCATGACCTCTGCTTCAAGGGAAAAGAAGAGATGATAAGATCGAACATGAACACCATGCGGAGGCGGATGCTGAGTGGCCTTGGCTCATCACCCCCACGGTGTGCATGGAAGTGTGGGCAGTGTACCCCTTGCAG...

Protein

Download Protein FASTA

174 aa · TkA05G038700|TK1151|PROTEIN

MGLQLKTKSSSFSILLIVTVCVLLPTPALAFGFGLRAAKVHDHDLCFKGKEEMIRSNMNTMRRRMLSGLGSSPPRCAWKCGQCTPCRPIHVAVPPGKPVTMEYYPEAWRCKCRNKFKLSNGSLSAFHSRAPGSSSFTGQTLPLGIPRKSSMSCSQQESISRPFSPSRVYIHHLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G038700`
TK1151 ID	TkA05G038700
OH-1004 ID	LXL04_000703
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.900
Protein coverage (%)	TK1151 47.126 / OH-1004 55.556 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G038700

Location Chr05:10496715-10499063 (-)

Description Similar to EPFL6: EPIDERMAL PATTERNING FACTOR-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30370`	Acts primarily as positive regulator of inflorescence growth.	Regional specification of stomatal production by the putative ligand CHALLAH.2010 · DOI: 10.1242/dev.040931 Generation of signaling specificity in Arabidopsis by spatially restricted buffering of ligand-receptor interactions.2011 · DOI: 10.1105/tpc.111.086637 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196
`At3g22820`	Controls stomatal patterning.	Generation of signaling specificity in Arabidopsis by spatially restricted buffering of ligand-receptor interactions.2011 · DOI: 10.1105/tpc.111.086637 EPIDERMAL PATTERNING FACTOR LIKE5 peptide represses stomatal development by inhibiting meristemoid maintenance in Arabidopsis thaliana.2013 · DOI: 10.1271/bbb.130145
`At4g14723`	Acts primarily as positive regulator of inflorescence growth.	Generation of signaling specificity in Arabidopsis by spatially restricted buffering of ligand-receptor interactions.2011 · DOI: 10.1105/tpc.111.086637 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000703 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080086 stamen filament development Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G30370

ath:AT3G22820

ath:AT4G14723

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.558

Rank 1 · TkA05G038700 · TK1151

Cell membrane0.157

Rank 2 · TkA05G038700 · TK1151

Endoplasmic reticulum0.144

Rank 3 · TkA05G038700 · TK1151

Cytoplasm0.099

Rank 4 · TkA05G038700 · TK1151

Nucleus0.071

Rank 5 · TkA05G038700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10589NADH_4Fe-4S52-74 aa

PF17181EPF69-116 aa

PF10589NADH_4Fe-4S80-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G038700	`PF10589`	NADH_4Fe-4S	52	74	4.5	8.0
TkA05G038700	`PF17181`	EPF	69	116	1.7e-17	63.8
TkA05G038700	`PF10589`	NADH_4Fe-4S	80	87	4.5	8.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PEY6`	Arabidopsis thaliana	sp\|Q1PEY6\|EPFL6_ARATH EPIDERMAL PATTERNING FACTOR-like protein 6	75.000%	Swiss-Prot	Low
`Q9LUH9`	Arabidopsis thaliana	sp\|Q9LUH9\|EPFL5_ARATH EPIDERMAL PATTERNING FACTOR-like protein 5	50.000%	Swiss-Prot	Low
`Q2V3I3`	Arabidopsis thaliana	sp\|Q2V3I3\|EPFL4_ARATH EPIDERMAL PATTERNING FACTOR-like protein 4	56.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card