TkA05G038530 | RubberDandelionOmics

Gene overview

TkA05G038530

Reference: TK1151 Chr: Chr05 Coordinates: 10437719-10438931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA05G038530|TK1151|cDNA

ATGGATGATTCTCAAGGATCCTATCAACCCAACTCCCATGGCATCCCAATAGATCTGTTCGTCTCCAAGAAGAATTCTTCCAATCTCAAGTTCACCGACTCTTCTGCAAATCTCGTCTTTTCCGTTGACCCTCCTATATCTCACTTCCGTCATCGGCGATTAACTTCTCCTCCGTTTTTAAACGTGTACTTGTCGATTCTTAAATCAACATGGCAGGGTTACAGGAATGACAGTAATGAAGAGAAGGATCTGATGTTCAG...

CDS

Download CDS FASTA

555 bp · TkA05G038530|TK1151|CDS

ATGGATGATTCTCAAGGATCCTATCAACCCAACTCCCATGGCATCCCAATAGATCTGTTCGTCTCCAAGAAGAATTCTTCCAATCTCAAGTTCACCGACTCTTCTGCAAATCTCGTCTTTTCCGTTGACCCTCCTATATCTCACTTCCGTCATCGGCGATTAACTTCTCCTCCGTTTTTAAACGTGTACTTGTCGATTCTTAAATCAACATGGCAGGGTTACAGGAATGACAGTAATGAAGAGAAGGATCTGATGTTCAG...

Protein

Download Protein FASTA

184 aa · TkA05G038530|TK1151|PROTEIN

MDDSQGSYQPNSHGIPIDLFVSKKNSSNLKFTDSSANLVFSVDPPISHFRHRRLTSPPFLNVYLSILKSTWQGYRNDSNEEKDLMFRVERTKNEHTTLEFQVFVNNGNPNKSVFKMRGSPFHRSCTIYKGDSIVAQTSLMYKLGFRNVVVPRNKFRLTIFPGYAEHDFVVALTVIFFYGRKLWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G038530`
TK1151 ID	TkA05G038530
OH-1004 ID	LXL04_019292
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.700
Protein coverage (%)	TK1151 94.565 / OH-1004 72.426 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G038530

Location Chr05:10437719-10438931 (+)

Description Similar to At2g30270: Protein LURP-one-related 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30270`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019292 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT1G33840

ath:AT2G30270

ath:AT3G11740

ath:AT3G16900

ath:AT5G01750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420

Rank 1 · TkA05G038530 · TK1151

Nucleus0.382

Rank 2 · TkA05G038530 · TK1151

Cell membrane0.299

Rank 3 · TkA05G038530 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA05G038530 · TK1151

Lysosome / Vacuole0.061

Rank 5 · TkA05G038530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525LOR18-176 aa

PF07642BBP259-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G038530	`PF04525`	LOR	18	176	2.5e-26	93.9
TkA05G038530	`PF07642`	BBP2	59	119	0.074	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWL2`	Arabidopsis thaliana	sp\|Q8GWL2\|LOR7_ARATH Protein LURP-one-related 7	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card