TkA05G036920 | RubberDandelionOmics

Gene overview

TkA05G036920

Reference: TK1151 Chr: Chr05 Coordinates: 10023562-10024275 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

632 bp · TkA05G036920|TK1151|cDNA

TACCAAACAAATCCCCTCTTCTTTTTTCCTCTACAATCCAAGCTGTGTTGGAAGTGATGGCAAGGGGAGAAATGGTTAGGAAGGTGGCGGTGGCGGTGATCTTCTATTGCCTGGTGGTGCCGCCACCACGAGCAGTGGAAGGCCAAGTAAGCTGTCCACTGGTGGTAACCAGCCTTCTACCTTGTGCCGCCTACCTGACAACTGGAGGTCCAGTATCCCGACATTGTTGTAGCGGCGTTAGGTCACTAAAAAGTGCCGCC...

CDS

Download CDS FASTA

366 bp · TkA05G036920|TK1151|CDS

ATGGCAAGGGGAGAAATGGTTAGGAAGGTGGCGGTGGCGGTGATCTTCTATTGCCTGGTGGTGCCGCCACCACGAGCAGTGGAAGGCCAAGTAAGCTGTCCACTGGTGGTAACCAGCCTTCTACCTTGTGCCGCCTACCTGACAACTGGAGGTCCAGTATCCCGACATTGTTGTAGCGGCGTTAGGTCACTAAAAAGTGCCGCCACAACCACCGATGACCGCCAGACGGCTTGCCAATGTATGGAACATGCCGCGGCAAT...

Protein

Download Protein FASTA

121 aa · TkA05G036920|TK1151|PROTEIN

MARGEMVRKVAVAVIFYCLVVPPPRAVEGQVSCPLVVTSLLPCAAYLTTGGPVSRHCCSGVRSLKSAATTTDDRQTACQCMEHAAAMLPGINIYNARSLPAKCDVDVAYDINPDTDCSKVH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G036920`
TK1151 ID	TkA05G036920
OH-1004 ID	LXL04_019277
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.100
Protein coverage (%)	TK1151 100.000 / OH-1004 96.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G036920

Location Chr05:10023562-10024275 (+)

Description Similar to Non-specific lipid-transfer protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0115350`	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes.	No verified direct reference in this release
`UniProt: A2ZAT0`	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes.	No verified direct reference in this release
`Os12g0115000`	Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019277 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0006952 defense response Biological Process

GO:0008289 lipid binding Molecular Function

KEGG gene cross-reference

nta:107812329

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.597

Rank 1 · TkA05G036920 · TK1151

Lysosome / Vacuole0.190

Rank 2 · TkA05G036920 · TK1151

Cytoplasm0.137

Rank 3 · TkA05G036920 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA05G036920 · TK1151

Cell membrane0.059

Rank 5 · TkA05G036920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_223-109 aa

PF00234Tryp_alpha_amyl33-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G036920	`PF14368`	LTP_2	23	109	2.6e-05	25.0
TkA05G036920	`PF00234`	Tryp_alpha_amyl	33	117	4.3e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJ39`	Oryza sativa subsp. japonica	sp\|Q7XJ39\|NLT2A_ORYSJ Non-specific lipid-transfer protein 2A	43.000%	Swiss-Prot	Medium
`A2ZAT0`	Oryza sativa subsp. indica	sp\|A2ZAT0\|NLTP2_ORYSI Non-specific lipid-transfer protein 2	43.000%	Swiss-Prot	Medium
`Q2QYL2`	Oryza sativa subsp. japonica	sp\|Q2QYL2\|NLT2B_ORYSJ Non-specific lipid-transfer protein 2B	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card