TkA05G036860 | RubberDandelionOmics

Gene overview

TkA05G036860

Reference: TK1151 Chr: Chr05 Coordinates: 10000673-10005213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1817 bp · TkA05G036860|TK1151|cDNA

TGAAAATACCTTAAGCGGAAAATATATATACCTTAATTCGACATGTAATCTTAGGTTAAACATCTGATTAGAGACAGCAGCCGTCAAGCTCCAAAAACTCGCCTGCAATGTCATCCAAAAACTCGCCTGCAATGTCTTCATCAAGCAGGAACATGAACGTTACTAAATTTCGAGACCTCGATCCACAAATACTTGATTTCACTATCAAAGTGCGTGTTTTGAAAAAATGGAATATTCCATCTAGATACAATGAGAACGAG...

CDS

Download CDS FASTA

822 bp · TkA05G036860|TK1151|CDS

ATGATGATTTTTGGACAAACCATCCAATTAAATATATCAATGAAGTTTTGGATCCAATCCAGGCAAGATCAAGAATGGTACTACCTAAGTTGCACAGCATGCCCATCAAAGGTTACAGAAAAATGGCTTACTAAAGATCTTCCGGATGGCTCCAAGTCCGACCCGTCTATGGTATTTGAATGTAAGAACAGGAGGTGCCAAAAACTGAATAAAGATCCTATTCCAAGGTTTAAAATTCCAGTGGTTGTTCAAGATTCTAA...

Protein

Download Protein FASTA

273 aa · TkA05G036860|TK1151|PROTEIN

MMIFGQTIQLNISMKFWIQSRQDQEWYYLSCTACPSKVTEKWLTKDLPDGSKSDPSMVFECKNRRCQKLNKDPIPRFKIPVVVQDSNGSIVLTLFDRDAMSLVRHSCKALVEKINRLEFNLALFPDELNVLKNLHLEFKVVSGQYNVTNQNTQYSISKVSNDTELIKELTQKLNMQSQNSESLSHVPCHSDSVQNINFKDDISQSVGENISPSSLTKSASYLNDMPSTSSTMKRNLNEVIDVDDTTQSSTTKTRRLDGVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G036860`
TK1151 ID	TkA05G036860
OH-1004 ID	LXL04_030156
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 93.407 / OH-1004 54.839 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G036860`
Location	Chr05:10000673-10005213 (-)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030156` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA05G036860 · TK1151

Cytoplasm0.115

Rank 2 · TkA05G036860 · TK1151

Cell membrane0.015

Rank 3 · TkA05G036860 · TK1151

Mitochondrion0.015

Rank 4 · TkA05G036860 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA05G036860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09086DUF192414-38 aa

PF08646Rep_fac-A_C16-160 aa

PF05083LST116-62 aa

PF12326EOS123-148 aa

PF09086DUF192495-113 aa

PF05557MAD99-183 aa

PF00961LAGLIDADG_1110-179 aa

PF05083LST1110-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G036860	`PF09086`	DUF1924	14	38	0.0025	18.9
TkA05G036860	`PF08646`	Rep_fac-A_C	16	160	2.2e-07	31.5
TkA05G036860	`PF05083`	LST1	16	62	0.22	12.4
TkA05G036860	`PF12326`	EOS1	23	148	0.15	12.7
TkA05G036860	`PF09086`	DUF1924	95	113	0.0025	18.9
TkA05G036860	`PF05557`	MAD	99	183	0.026	13.7
TkA05G036860	`PF00961`	LAGLIDADG_1	110	179	0.16	13.5
TkA05G036860	`PF05083`	LST1	110	122	0.22	12.4
TkA05G036860	`PF09086`	DUF1924	120	144	0.0025	18.9
TkA05G036860	`PF12308`	Noelin-1	131	184	0.33	11.8
TkA05G036860	`PF09086`	DUF1924	175	247	0.0025	18.9
TkA05G036860	`PF05083`	LST1	175	196	0.22	12.4
TkA05G036860	`PF12308`	Noelin-1	222	241	0.33	11.8
TkA05G036860	`PF00961`	LAGLIDADG_1	229	240	0.16	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card