TkA05G036410 | RubberDandelionOmics

Gene overview

TkA05G036410

Reference: TK1151 Chr: Chr05 Coordinates: 9860330-9861045 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkA05G036410|TK1151|cDNA

ATGTGTGGTACTCCTGCTTATGTTGCGCCGGAGATTTTGGCGAAGAAAGGTTACGACGGAGCGAAGGTTGATATCTGGTCTTGTGGAATCATTTTATACGTCCTCAACGCCGGTTATCTACCTTTTAACGATCCGAATCTGATGGTGATGTACCGGAAAATTTACAAAGGAGAATTTCGTGTTCCGAAATGGACTTCACCGGAGCTAAAACGGTTATTATCGCGTCTCCTCGACACGAATCCTCAGACGAGGATCACCGT...

CDS

Download CDS FASTA

621 bp · TkA05G036410|TK1151|CDS

ATGTGTGGTACTCCTGCTTATGTTGCGCCGGAGATTTTGGCGAAGAAAGGTTACGACGGAGCGAAGGTTGATATCTGGTCTTGTGGAATCATTTTATACGTCCTCAACGCCGGTTATCTACCTTTTAACGATCCGAATCTGATGGTGATGTACCGGAAAATTTACAAAGGAGAATTTCGTGTTCCGAAATGGACTTCACCGGAGCTAAAACGGTTATTATCGCGTCTCCTCGACACGAATCCTCAGACGAGGATCACCGT...

Protein

Download Protein FASTA

206 aa · TkA05G036410|TK1151|PROTEIN

MCGTPAYVAPEILAKKGYDGAKVDIWSCGIILYVLNAGYLPFNDPNLMVMYRKIYKGEFRVPKWTSPELKRLLSRLLDTNPQTRITVDEIIKDPWFRIGYKDEAFHPINSSLFDDQDSGEMFLSTVAPEEIIERVADAAEEESLTVAKRKKWCVKVDGGQYGNFTLTLEVKRLTEELVVVEVRWRENESEPVQKYGKISYGRSCVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G036410`
TK1151 ID	TkA05G036410
OH-1004 ID	LXL04_019270
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.000
Protein coverage (%)	TK1151 92.718 / OH-1004 51.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G036410

Location Chr05:9860330-9861045 (-)

Description Similar to CIPK14: CBL-interacting serine/threonine-protein kinase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01820`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At2g38490`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At2g30360`	CIPK serine-threonine protein kinases interact with CBL proteins.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626
`At2g34180`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0514200`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019270 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009268 response to pH Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0019722 calcium-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G29230

ath:AT2G30360

ath:AT4G18700

ath:AT5G01820

ath:AT5G45810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.497

Rank 1 · TkA05G036410 · TK1151

Cytoplasm0.481

Rank 2 · TkA05G036410 · TK1151

Cell membrane0.090

Rank 3 · TkA05G036410 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA05G036410 · TK1151

Golgi apparatus0.038

Rank 5 · TkA05G036410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase1-96 aa

PF07714PK_Tyr_Ser-Thr6-92 aa

PF03822NAF73-88 aa

PF23803Phage_TAC_17102-147 aa

PF03822NAF110-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G036410	`PF00069`	Pkinase	1	96	8e-22	78.6
TkA05G036410	`PF07714`	PK_Tyr_Ser-Thr	6	92	1.4e-06	28.5
TkA05G036410	`PF03822`	NAF	73	88	1.9e-05	25.4
TkA05G036410	`PF23803`	Phage_TAC_17	102	147	0.085	13.6
TkA05G036410	`PF03822`	NAF	110	148	1.9e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZW4`	Arabidopsis thaliana	sp\|Q9LZW4\|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14	78.900%	Swiss-Prot	Medium
`O80902`	Arabidopsis thaliana	sp\|O80902\|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22	41.300%	Swiss-Prot	Medium
`O22932`	Arabidopsis thaliana	sp\|O22932\|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11	74.800%	Swiss-Prot	Medium
`O22971`	Arabidopsis thaliana	sp\|O22971\|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13	64.300%	Swiss-Prot	Medium
`Q68Y49`	Oryza sativa subsp. japonica	sp\|Q68Y49\|CIPKJ_ORYSJ CBL-interacting protein kinase 19	63.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card