TkA05G036230 | RubberDandelionOmics

Gene overview

TkA05G036230

Reference: TK1151 Chr: Chr05 Coordinates: 9795645-9805788 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3039 bp · TkA05G036230|TK1151|cDNA

ATGGATACATCAGCCATATCACCTCAAACCCTAGCCATTGCTCATCAAAATTGTTACGCTAATCTTGACTATACCAAATACCCACCAACACTTCATGTGTTAATCGAATTCCTAAAATCATCTGTCCTAAATAAAGCTCTCACCGCTCATGCAGTTATTTCCCGCAAAGCACTGACCAAAGCTTATTCAAGTGCAAAGTATAACTCAGCAAAGAACATCGTTGAGTTTGATCTGGAATCAGGAAAACGCACCGCCATTAC...

CDS

Download CDS FASTA

3039 bp · TkA05G036230|TK1151|CDS

ATGGATACATCAGCCATATCACCTCAAACCCTAGCCATTGCTCATCAAAATTGTTACGCTAATCTTGACTATACCAAATACCCACCAACACTTCATGTGTTAATCGAATTCCTAAAATCATCTGTCCTAAATAAAGCTCTCACCGCTCATGCAGTTATTTCCCGCAAAGCACTGACCAAAGCTTATTCAAGTGCAAAGTATAACTCAGCAAAGAACATCGTTGAGTTTGATCTGGAATCAGGAAAACGCACCGCCATTAC...

Protein

Download Protein FASTA

1012 aa · TkA05G036230|TK1151|PROTEIN

MDTSAISPQTLAIAHQNCYANLDYTKYPPTLHVLIEFLKSSVLNKALTAHAVISRKALTKAYSSAKYNSAKNIVEFDLESGKRTAITKSSFTKLFNLSTDQALIDPDKVSSADMIHAFNQMGHTPILTRLSAFKKNRLPSIWSCLFTILFKCLAERQTGTDSASKQFLTLMYALFTDSPIDLGKILWTQFCESPSSATKDIEISMGRFWSLVVDYAHRHYKISSTEPLPDDDIAIFPELQIGKLTIKSDNFCEFFGKIPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G036230`
TK1151 ID	TkA05G036230
OH-1004 ID	LXL04_037282
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.800
Protein coverage (%)	TK1151 98.617 / OH-1004 79.712 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G036230`
Location	Chr05:9795645-9805788 (+)
Description	Similar to EEF1AKMT2: EEF1A lysine methyltransferase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037282` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006479 protein methylation Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference	dre:503749 hsa:399818 mmu:72096 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.814

Rank 1 · TkA05G036230 · TK1151

Cytoplasm0.237

Rank 2 · TkA05G036230 · TK1151

Mitochondrion0.039

Rank 3 · TkA05G036230 · TK1151

Cell membrane0.021

Rank 4 · TkA05G036230 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA05G036230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20668DUF681594-146 aa

PF22788COP9_hel_rpt493-619 aa

PF28231STB2_C509-624 aa

PF05802SctB2512-567 aa

PF20529DUF6744562-629 aa

PF20668DUF6815565-606 aa

PF08838DUF1811577-617 aa

PF05802SctB2697-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G036230	`PF20668`	DUF6815	94	146	0.072	14.7
TkA05G036230	`PF22788`	COP9_hel_rpt	493	619	0.017	15.4
TkA05G036230	`PF28231`	STB2_C	509	624	0.97	10.6
TkA05G036230	`PF05802`	SctB2	512	567	3.0	9.0
TkA05G036230	`PF20529`	DUF6744	562	629	0.43	10.7
TkA05G036230	`PF20668`	DUF6815	565	606	0.072	14.7
TkA05G036230	`PF08838`	DUF1811	577	617	5.5	8.1
TkA05G036230	`PF05802`	SctB2	697	733	3.0	9.0
TkA05G036230	`PF20668`	DUF6815	707	774	0.072	14.7
TkA05G036230	`PF28231`	STB2_C	719	738	0.97	10.6
TkA05G036230	`PF08838`	DUF1811	719	739	5.5	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card