TkA05G036050 | RubberDandelionOmics

Gene overview

TkA05G036050

Reference: TK1151 Chr: Chr05 Coordinates: 9732273-9733640 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA05G036050|TK1151|cDNA

ATGTTGACTATCCTTGAAAACTGCAGAATATCTCCGCCCTCGGCCACCGTCGGCGACAACTCCCTGCCCCTCACTTTCCTCGACATCATATTCCTGCTCCACTTTCCGATTCACCAGCTTTTCTTTTATGATTTCCCACACTCCAAACCTCAATTCATCCAAACAGTTATCCCCACTCTCAAACACTCATTATCCATCACTCTTCAACACTTTTTCCCATTCGCAAGCAACTTAATTGTGTTTCCTAATGGAAGAAAACC...

CDS

Download CDS FASTA

1107 bp · TkA05G036050|TK1151|CDS

ATGTTGACTATCCTTGAAAACTGCAGAATATCTCCGCCCTCGGCCACCGTCGGCGACAACTCCCTGCCCCTCACTTTCCTCGACATCATATTCCTGCTCCACTTTCCGATTCACCAGCTTTTCTTTTATGATTTCCCACACTCCAAACCTCAATTCATCCAAACAGTTATCCCCACTCTCAAACACTCATTATCCATCACTCTTCAACACTTTTTCCCATTCGCAAGCAACTTAATTGTGTTTCCTAATGGAAGAAAACC...

Protein

Download Protein FASTA

368 aa · TkA05G036050|TK1151|PROTEIN

MLTILENCRISPPSATVGDNSLPLTFLDIIFLLHFPIHQLFFYDFPHSKPQFIQTVIPTLKHSLSITLQHFFPFASNLIVFPNGRKPEIRYVDGDSVELTVAESHLDFEDLVGNHPRACENFYPLVPPLGRVTKLSEFLSIPLFAVQVTYFENLGFSIGITNHHVLCDASSKFVFLKAWTSIARYACGYVWSCIAKSRVGFHKRKGEDELERFVCLANFRNRMDPPLPETYFGNCVGPCVAVEKSMLLSGNEGFFFAVGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G036050`
TK1151 ID	TkA05G036050
OH-1004 ID	LXL04_019266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 94.022 / OH-1004 97.085 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G036050

Location Chr05:9732273-9733640 (-)

Description Similar to 3MAT: Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03495`	Involved in the acylation of the 6'' position of the 3-O-glucose residue of anthocyanin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006805 xenobiotic metabolic process Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016420 malonyltransferase activity Molecular Function

GO:0033809 anthocyanin 6''-O-malonyltransferase activity Molecular Function

GO:0033810 anthocyanin 5-O-glucoside 6'''-O-malonyltransferase activity Molecular Function

GO:0047165 flavonol-3-O-beta-glucoside O-malonyltransferase activity Molecular Function

GO:0047183 anthocyanin 5-(6'''-hydroxycinnamoyltransferase) activity Molecular Function

GO:0102453 anthocyanidin 3-O-glucoside 6''-O-acyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AAL50566

ag:AAO12206

ag:BAA74428

ag:BAA93475

nta:107782063

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.810

Rank 1 · TkA05G036050 · TK1151

Nucleus0.294

Rank 2 · TkA05G036050 · TK1151

Endoplasmic reticulum0.079

Rank 3 · TkA05G036050 · TK1151

Cell membrane0.051

Rank 4 · TkA05G036050 · TK1151

Lysosome / Vacuole0.032

Rank 5 · TkA05G036050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase2-184 aa

PF02458Transferase187-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G036050	`PF02458`	Transferase	2	184	6.9e-47	160.8
TkA05G036050	`PF02458`	Transferase	187	359	6.9e-47	160.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LR73`	Arabidopsis thaliana	sp\|Q9LR73\|3AT2_ARATH Coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 2	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card