TkA05G032740 | RubberDandelionOmics

Gene overview

TkA05G032740

Reference: TK1151 Chr: Chr05 Coordinates: 8835592-8837506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1181 bp · TkA05G032740|TK1151|cDNA

CCAACCTATTCCGTAAACAACCACTACTCGTCGGCTTTCAACCCTTGTGGTGGTGATTGTCACATATCTCATATCTGGGCTAAGAACAACCATCAAAATGTCGTCTAGCCCATGCTATTCATCAGATGACGATCGTTCTAGTAAAGGAACCCCTGATCGTGTTATGAAGGAGCCTGAATATCCTGTGGTAATTGTAGACCAGAAATATTGTTCCAACTACCCCATGCAGTTAACTTTCGAGAAGAACCATGCCGTGGAAG...

CDS

Download CDS FASTA

657 bp · TkA05G032740|TK1151|CDS

ATGTCGTCTAGCCCATGCTATTCATCAGATGACGATCGTTCTAGTAAAGGAACCCCTGATCGTGTTATGAAGGAGCCTGAATATCCTGTGGTAATTGTAGACCAGAAATATTGTTCCAACTACCCCATGCAGTTAACTTTCGAGAAGAACCATGCCGTGGAAGACAAGTTCAAAATAAAGGATGAAGACGGAAATGTTATATTTAAAGCCAGTAAGAAGAAGGGTGGCAAACGCATTATGGTAGACGAGACAGACACGCC...

Protein

Download Protein FASTA

218 aa · TkA05G032740|TK1151|PROTEIN

MSSSPCYSSDDDRSSKGTPDRVMKEPEYPVVIVDQKYCSNYPMQLTFEKNHAVEDKFKIKDEDGNVIFKASKKKGGKRIMVDETDTPVISFTTKHITMHRRRQAYKGDPHEHHRLFTVKKTRGFKSLRYDVFMTSNMTESTFNYRVYDNFKDGTSIIMAQDKTTILAQLHTEVTHKKEVKDEEKFSVSLSPNVDKAFVSALLIIREEVRKSRYKGYES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G032740`
TK1151 ID	TkA05G032740
OH-1004 ID	LXL04_019239
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G032740`
Location	Chr05:8835592-8837506 (+)
Description	Similar to At5g01750: Protein LURP-one-related 15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019239` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009751 response to salicylic acid Biological Process GO:0050832 defense response to fungus Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0019904 protein domain specific binding Molecular Function
KEGG gene cross-reference	ath:AT1G33840 ath:AT2G14560 ath:AT3G11740 ath:AT3G16900 ath:AT5G01750 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · TkA05G032740 · TK1151

Cell membrane0.357

Rank 2 · TkA05G032740 · TK1151

Nucleus0.285

Rank 3 · TkA05G032740 · TK1151

Extracellular0.066

Rank 4 · TkA05G032740 · TK1151

Lysosome / Vacuole0.063

Rank 5 · TkA05G032740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17961Big_840-81 aa

PF04525LOR44-204 aa

PF12619MCM2_N45-111 aa

PF17961Big_8168-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G032740	`PF17961`	Big_8	40	81	0.00017	22.4
TkA05G032740	`PF04525`	LOR	44	204	7.5e-23	82.6
TkA05G032740	`PF12619`	MCM2_N	45	111	0.12	13.4
TkA05G032740	`PF17961`	Big_8	168	195	0.00017	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card