TkA05G032360 | RubberDandelionOmics

Gene overview

TkA05G032360

Reference: TK1151 Chr: Chr05 Coordinates: 8741507-8742418 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

791 bp · TkA05G032360|TK1151|cDNA

TTTCATTCCCTTTTTTTTTACAAGAAACTCCTCCCCGTTACAAAATTAGAAGTTTCTACGTTCCCTTCAAGTCTCAAATCATGTTCTTCTCTGCCATCTCTTGATGCGGGATTCATGAAGCATGGGTACTTGATCAAATGCGGGGTTTTGGATTGCTGTGTTGATGTTGGGAATGATCTACTGAGGATGTATCTGACGCATGGAGAATTTGGGGATGCTTATAAGGTGTTCGATGAAATGCCTATGAAAAGCAAAGGCGA...

CDS

Download CDS FASTA

519 bp · TkA05G032360|TK1151|CDS

TTTCATTCCCTTTTTTTTTACAAGAAACTCCTCCCCGTTACAAAATTAGAAGTTTCTACGTTCCCTTCAAGTCTCAAATCATGTTCTTCTCTGCCATCTCTTGATGCGGGATTCATGAAGCATGGGTACTTGATCAAATGCGGGGTTTTGGATTGCTGTGTTGATGTTGGGAATGATCTACTGAGGATGTATCTGACGCATGGAGAATTTGGGGATGCTTATAAGGTGTTCGATGAAATGCCTATGAAAAGCAAAGGCGA...

Protein

Download Protein FASTA

172 aa · TkA05G032360|TK1151|PROTEIN

FHSLFFYKKLLPVTKLEVSTFPSSLKSCSSLPSLDAGFMKHGYLIKCGVLDCCVDVGNDLLRMYLTHGEFGDAYKVFDEMPMKSKGDLFDRIIHELGTNRAYEDVILAFEKMVELSIFPNVHSLCHVIKACSNLTSIKSGQFVHNFVTQNGFENQDMHKTKTPSKSLTFLYP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G032360`
TK1151 ID	TkA05G032360
OH-1004 ID	LXL04_019232
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 90.116 / OH-1004 19.821 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G032360

Location Chr05:8741507-8742418 (-)

Description Similar to PCMP-E36: Pentatricopeptide repeat-containing protein At4g21300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12770`	Pentatricopeptide repeat-containing protein At3g12770.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G03580

ath:AT4G21300

ath:AT4G33990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.710

Rank 1 · TkA05G032360 · TK1151

Plastid0.084

Rank 2 · TkA05G032360 · TK1151

Nucleus0.069

Rank 3 · TkA05G032360 · TK1151

Cytoplasm0.049

Rank 4 · TkA05G032360 · TK1151

Cell membrane0.007

Rank 5 · TkA05G032360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR34-47 aa

PF13041PPR_258-82 aa

PF01535PPR58-82 aa

PF13812PPR_358-80 aa

PF13041PPR_291-132 aa

PF13812PPR_392-132 aa

PF01535PPR94-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G032360	`PF01535`	PPR	34	47	0.0011	19.8
TkA05G032360	`PF13041`	PPR_2	58	82	2.3e-08	34.7
TkA05G032360	`PF01535`	PPR	58	82	0.0011	19.8
TkA05G032360	`PF13812`	PPR_3	58	80	0.11	13.3
TkA05G032360	`PF13041`	PPR_2	91	132	2.3e-08	34.7
TkA05G032360	`PF13812`	PPR_3	92	132	0.11	13.3
TkA05G032360	`PF01535`	PPR	94	115	0.0011	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTV8`	Arabidopsis thaliana	sp\|Q9LTV8\|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770	29.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card